ASF1B-specific Polyclonal antibody, PBS Only

• 

  WB analysis using 22258-1-AP (same clone as 22258-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 22258-1-AP (ASF1B-specific antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 22258-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 22258-1-AP (same clone as 22258-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 22258-1-AP (ASF1B-specific antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 22258-1-PBS in a different storage buffer formulation.

• 

  WB analysis of A431 using 22258-1-AP (same clone as 22258-1-PBS)

  A431 cells were subjected to SDS PAGE followed by western blot with 22258-1-AP (ASF1B antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 22258-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lymphoma using 22258-1-AP (same clone as 22258-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lymphoma tissue slide using 22258-1-AP (ASF1B-specific antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 22258-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lymphoma using 22258-1-AP (same clone as 22258-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lymphoma tissue slide using 22258-1-AP (ASF1B-specific antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 22258-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lymphoma using 22258-1-AP (same clone as 22258-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lymphoma tissue slide using 22258-1-AP (ASF1B-specific antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 22258-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lymphoma using 22258-1-AP (same clone as 22258-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lymphoma tissue slide using 22258-1-AP (ASF1B-specific antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 22258-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 22258-1-AP (same clone as 22258-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using ASF1B-specific antibody (22258-1-AP) at dilution of 1:1000 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 22258-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

ASF1B-specific Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 22258-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

ASF1A/B, ASF1B, Anti-silencing function protein 1 homolog B, CCG1-interacting factor A-II, CIA II

---

Product Information

22258-1-PBS targets ASF1B-specific in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag17763

  Product name: Recombinant human ASF1B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 151-202 aa of BC010014

  Sequence: INWDNNMDRLEAIETQDPSLGCGLPLNCTPIKGLGLPGCIPGLLPENSMDCI

• Full Name: ASF1 anti-silencing function 1 homolog B (S. cerevisiae)
• Calculated Molecular Weight: 202 aa, 22 kDa
• Observed Molecular Weight: 20-22 kDa
• GenBank Accession Number: BC010014
• Gene Symbol: ASF1B
• Gene ID (NCBI): 55723
• RRID: AB_2879051
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NVP2
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

ASF1B is a member of the H3/H4 family of histone chaperone proteins and is similar to the anti-silencing function-1 gene in yeast. The encoded protein is the substrate of the tousled-like kinase family of cell cycle-regulated kinases and may play a key role in modulating the nucleosome structure of chromatin by ensuring a constant supply of histones at sites of nucleosome assembly. This antibody specifically reacts with the 19kd ASF1B protein.