ASH2L Monoclonal antibody, PBS Only

• 

  WB analysis using 67859-1-Ig (same clone as 67859-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67859-1-Ig (ASH2L antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67859-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 67859-1-Ig (same clone as 67859-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67859-1-Ig (ASH2L antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67859-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 67859-1-Ig (same clone as 67859-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 67859-1-Ig (ASH2L antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67859-1-PBS in a different storage buffer formulation.

• 

  FC experiment of HeLa using 67859-1-Ig (same clone as 67859-1-PBS)

  1X10^6 HeLa cells were intracellularly stained with 0.4 ug Anti-Human ASH2L (67859-1-Ig, Clone:1G1H3) and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) at dilution 1:1000 (red), or 0.4 ug Mouse IgG2a Isotype Control (C1.18.4) (65208-1-Ig, Clone: C1.18.4) (blue). Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011). This data was developed using the same antibody clone with 67859-1-PBS in a different storage buffer formulation.

ASH2L Monoclonal Antibody for Indirect ELISA, IHC, WB

Cat No. 67859-1-PBS

Clone No.1G1H3

Host / Isotype

Mouse / IgG2a

Reactivity

rat, human

Applications

Indirect ELISA, IHC, WB

Synonyms

Bre2, ASH2-like protein, ASH2L2, ASH2L1, ASH2 like protein

---

Product Information

67859-1-PBS targets ASH2L in Indirect ELISA, IHC, WB applications and shows reactivity with rat, human samples.

• Tested Reactivity: rat, human
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3008

  Product name: Recombinant human ASH2L protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 234-534 aa of BC015936

  Sequence: HGYPLEHPFNKDGYRYILAEPDPHAPDPEKLELDCWAGKPIPGDLYRACLYERVLLALHDRAPQLKISDDRLTVVGEKGYSMVRASHGVRKGAWYFEITVDEMPPDTAARLGWSQPLGNLQAPLGYDKFSYSWRSKKGTKFHQSIGKHYSSGYGQGDVLGFYINLPEDTETAKSLPDTYKDKALIKFKSYLYFEEKDFVDKAEKSLKQTPHSEIIFYKNGVNQGVAYKDIFEGVYFPAISLYKSCTVSINFGPCFKYPPKDLTYRPMSDMGWGAVVEHTLADVLYHVETEVDGRRSPPWEP

• Full Name: ash2 (absent, small, or homeotic)-like (Drosophila)
• Calculated Molecular Weight: 628 aa, 69 kDa
• Observed Molecular Weight: 80 kDa
• GenBank Accession Number: BC015936
• Gene Symbol: ASH2L
• Gene ID (NCBI): 9070
• RRID: AB_2918617
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9UBL3
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.