ASL Monoclonal antibody, PBS Only

ASL Monoclonal Antibody for WB, Indirect ELISA
Cat No. 67692-1-PBS
Clone No.1G9H3

Host / Isotype

Mouse / IgG2b

Reactivity

Human, mouse, rat, pig

Applications

WB, Indirect ELISA

argininosuccinate lyase, Arginosuccinase, ASAL, ASL

Formulation:  PBS Only
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

67692-1-PBS targets ASL in WB, Indirect ELISA applications and shows reactivity with Human, mouse, rat, pig samples.

Tested Reactivity Human, mouse, rat, pig
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag30517

Product name: Recombinant human ASL protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 114-464 aa of BC008195

Sequence: NDQVVTDLRLWMRQTCSTLSGLLWELIRTMVDRAEAERDVLFPGYTHLQRAQPIRWSHWILSHAVALTRDSERLLEVRKRINVLPLGSGAIAGNPLGVDRELLRAELNFGAITLNSMDATSERDFVAEFLFWASLCMTHLSRMAEDLILYCTKEFSFVQLSDAYSTGSSLMPQKKNPDSLELIRSKAGRVFGRCAGLLMTLKGLPSTYNKDLQEDKEAVFEVSDTMSAVLQVATGVISTLQIHQENMGQALSPDMLATDLAYYLVRKGMPFRQAHEASGKAVFMAETKGVALNQLSLQELQTISPLFSGDVICVWDYGHSVEQYGALGGTARSSVDWQIRQVRALLQAQQA

Predict reactive species
Full Name argininosuccinate lyase
Calculated Molecular Weight 55 kDa
Observed Molecular Weight50 kDa
GenBank Accession NumberBC008195
Gene Symbol ASL
Gene ID (NCBI) 435
RRIDAB_2882885
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP04424
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Argininosuccinate lyase (ASL), one of the significant UC enzymes, catalyzes argininosuccinate cleavage to generate arginine and fumarate. Arginine is then catalyzed by arginase to ornithine and polyamines, which are found to promote cancer cell proliferation and growth. Importantly, ASL ectopic expression is closely associated with poor prognosis of colorectal cancer, hepatocellular. ASL is a member of the aspartase/fumarase superfamily. Enzymes of this superfamily share similar tetrameric structure and active site, though the sequence identities between different members are quite low (less than 20%). Members of this superfamily have been recognised as drug targets for microbial infections. ASL is a 464-amino-acid enzyme with a molecular mass of 49.7 kDa. (PMID: 22386318 PMID: 31018905)

Loading...
||
New chat Able
正在加载,请稍候...