ASPN Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• ASPN Polyclonal antibody, PBS Only (27602-1-PBS)

• 

  WB analysis of HepG2 using 27602-1-AP (same clone as 27602-1-PBS)

  HepG2 cells were subjected to SDS PAGE followed by western blot with 27602-1-AP (ASPN antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 27602-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 27602-1-AP (same clone as 27602-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 27602-1-AP (ASPN antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 27602-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human stomach cancer using 27602-1-AP (same clone as 27602-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 27602-1-AP (ASPN antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27602-1-PBS in a different storage buffer formulation.

ASPN Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 27602-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

SLRR1C, PLAP-1, PLAP1, PLAP 1, Periodontal ligament-associated protein 1

---

Product Information

27602-1-PBS targets ASPN in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26380

  Product name: Recombinant human ASPN protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 53-330 aa of BC063114

  Sequence: DDEEDNSLFPTREPRSHFFPFDLFPMCPFGCQCYSRVVHCSDLGLTSVPTNIPFDTRMLDLQNNKIKEIKENDFKGLTSLYGLILNNNKLTKIHPKAFLTTKKLRRLYLSHNQLSEIPLNLPKSLAELRIHENKVKKIQKDTFKGMNALHVLEMSANPLDNNGIEPGAFEGVTVFHIRIAEAKLTSVPKGLPPTLLELHLDYNKISTVELEDFKRYKELQRLGLGNNKITDIENGSLANIPRVREIHLENNKLKKIPSGLPELKYLQIIFLHSNSIAR

• Full Name: asporin
• Calculated Molecular Weight: 384 aa, 44 kDa
• Observed Molecular Weight: 43 kDa
• GenBank Accession Number: BC063114
• Gene Symbol: ASPN
• Gene ID (NCBI): 54829
• RRID: AB_3085974
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BXN1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

ASPN, also known as periodontal ligament-associated protein1 (PLAP1), is an extracellular matrix (ECM) protein. The calculated molecular weight of ASPN is 43 kDa. It belongs to the small leucine-rich proteoglycans (SLRPs) family and contains a unique aspartate-rich N terminus that distinguishes it from other SLRPs family members. It was firstly identified in human cartilage and it was associated with the pathogenesis of bone and joint diseases, including osteoarthritis, intervertebral disc degeneration and periodontal ligament mineralization (PMID:11152692; 26089687).