ASXL2 Polyclonal antibody

• 

  WB analysis using 27229-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 27229-1-AP (ASXL2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

ASXL2 Polyclonal Antibody for WB, ELISA

Cat No. 27229-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

Additional sex combs-like protein 2, ASXH2, KIAA1685

---

Tested Applications

• Positive WB detected in: HEK-293T cells, Jurkat cells, U2OS cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

27229-1-AP targets ASXL2 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag24402

  Product name: Recombinant human ASXL2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 744-918 aa of BC042999

  Sequence: LARDLIQAAQKQMAHAVRGKAIRSSPELFSSTVLPLPADSPTHQPLLLPPLQTPKLYGSPTQIGPSYRGMINVSTSSDMDHNSAVPGSQVSSNVGDVMSFSVTVTTIPASQAMNPSSHGQTIPVQAFSEENSIEGTPSKCYCRLKAMIMCKGCGAFCHDDCIGPSKLCVSCLVVR

• Full Name: additional sex combs like 2 (Drosophila)
• Calculated Molecular Weight: 154 kDa
• Observed Molecular Weight: 154-230 kDa
• GenBank Accession Number: BC042999
• Gene Symbol: ASXL2
• Gene ID (NCBI): 55252
• RRID: AB_3669589
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q76L83
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ASXL2 is an epigenetic regulator associated with various tumors including colorectal cancer, breast cancer, and myeloid leukemia. ASXL1, ASXL2 and ASXL3 are human homologs of Drosophila Asx (Additional sex combs) and function as epigenetic regulators through recruitment of Polycomb group repressor complexes (PRC) and Trithorax group activator complexes. ASXL proteins can interact with BAP1, NCOA1, EZH2, WTIP and nuclear receptors, which suggests diverse functions of ASXL family members in epigenetic and transcriptional regulation. (PMID: 30093396, PMID: 34692512)