ATAD2 Polyclonal antibody

• 

  WB analysis of HeLa using 23894-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 23894-1-AP (ATAD2 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  IP experiment of HeLa using 23894-1-AP

  IP result of anti-ATAD2 (IP:23894-1-AP, 4ug; Detection:23894-1-AP 1:500) with HeLa cells lysate 3200ug.

• 

  IF Staining of HeLa using 23894-1-AP

  Immunofluorescent analysis of (10% Formaldehyde) fixed HeLa cells using 23894-1-AP (ATAD2 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated Goat Anti-Rabbit IgG(H+L).

• Featured Product
• KD/KO Validated

ATAD2 Polyclonal Antibody for WB, IF/ICC, IP, ELISA

Cat No. 23894-1-AP

Publications(5)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, IP, ELISA

Synonyms

ANCCA, ATAD2, PRO2000

---

Tested Applications

• Positive WB detected in: HeLa cells
• Positive IP detected in: HeLa cells
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 2 publications below
• WB: See 4 publications below
• IF: See 1 publications below
• IP: See 1 publications below

Product Information

23894-1-AP targets ATAD2 in WB, IF/ICC, IP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag20947

  Product name: Recombinant human ATAD2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-150 aa of BC113656

  Sequence: MVVLRSSLELHNHSAASATGSLDLSSDFLSLEHIGRRRLRSAGAAQKKPAATTAKAGDGSSVKEVETYHRTRALRSLRKDAQNSSDSSFEKNVEITEQLANGRHFTRQLARQQADKKKEEHREDKVIPVTRSLRARNIVQSTEHLHEDNG

• Full Name: ATPase family, AAA domain containing 2
• Calculated Molecular Weight: 1390 aa, 159 kDa
• Observed Molecular Weight: 159 kDa
• GenBank Accession Number: BC113656
• Gene Symbol: ATAD2
• Gene ID (NCBI): 29028
• RRID: AB_2879352
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q6PL18
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ATAD2 is one of them encoding a conserved factor harbouring an AAA type ATPase domain and a bromodomain. ATAD2 controls chromatin dynamics, genome transcriptional activities and apoptotic cell response. This protein has 2 isoforms produced by alternative splicing.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
		Cell Rep; Proteomic profiling reveals distinct phases to the restoration of chromatin following DNA replication; Authors - Vanesa Alvarez
human	WB	Biomed Pharmacother; Silencing METTL3 inhibits the proliferation and invasion of osteosarcoma by regulating ATAD2.; Authors - Lei Zhou
human	WB,IF	Mol Cell Biol; Mutual Balance of Histone Deacetylases 1 and 2 and the Acetyl Reader ATAD2 Regulates the Level of Acetylation of Histone H4 on Nascent Chromatin of Human Cells.; Authors - Pavlo Lazarchuk ; KD Validated
human	WB,IP	Biochem Biophys Res Commun; ATAD2 drives colorectal cancer progression by regulating TRIM25 expression via a positive feedback loop with E2F transcriptional factors.; Authors - Yalin Tong ; KD Validated
human	WB	iScience; Genome-wide survey of D/E repeats in human proteins uncovers their instability and aids in identifying their role in the chromatin regulator ATAD2; Authors - Shalabh Shukla