ATAD3C Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• ATAD3C Polyclonal antibody, PBS Only (21881-1-PBS)

• 

  WB analysis using 21881-1-AP (same clone as 21881-1-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 21881-1-AP (ATAD3C antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21881-1-PBS in a different storage buffer formulation.

ATAD3C Polyclonal Antibody for WB, Indirect ELISA

Cat No. 21881-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

ATPase family AAA domain-containing protein 3C

---

Product Information

21881-1-PBS targets ATAD3C in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag16422

  Product name: Recombinant human ATAD3C protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-122 aa of BC101211

  Sequence: MPEDRTAGRVLAGHGVCLQGRGPDRGHDGRLRARLCPAAPADDALAEGGEAWARGRATLILSPWGDHTSRSLAADPSHPCLCGPAHLGNTPRNKVPRGPHRCVYWLTRGGVWGPLTSPWGQR

• Full Name: ATPase family, AAA domain containing 3C
• Calculated Molecular Weight: 473 aa, 52 kDa
• Observed Molecular Weight: 46 kDa
• GenBank Accession Number: BC101211
• Gene Symbol: ATAD3C
• Gene ID (NCBI): 219293
• RRID: AB_3669379
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q5T2N8
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

ATAD3 (ATPase family AAA Domain-containing protein 3) is a mitochondrial transmembrane protein involved in a variety of cellular processes. ATAD3 contains three isoforms: ATAD3A, ATAD3B and ATAD3C. ATAD3C has a negative dominant role in mitochondrial OXPHOS function and its expression regulates ATAD3A in cells (PMID: 38092275). This antibody can detect ATAD3C.