ATF7IP Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• ATF7IP Polyclonal antibody, PBS Only (14699-1-PBS)

• 

  IHC staining of human breast cancer using 14699-1-AP (same clone as 14699-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 14699-1-AP (ATF7IP antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 14699-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 14699-1-AP (same clone as 14699-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 14699-1-AP (ATF7IP antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 14699-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary tumor using 14699-1-AP (same clone as 14699-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 14699-1-AP (ATF7IP antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 14699-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human stomach cancer using 14699-1-AP (same clone as 14699-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 14699-1-AP (ATF7IP antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 14699-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human stomach cancer using 14699-1-AP (same clone as 14699-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 14699-1-AP (ATF7IP antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 14699-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

ATF7IP Polyclonal Antibody for IHC, Indirect ELISA

Cat No. 14699-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IHC, Indirect ELISA

Synonyms

ATF-interacting protein, ATFa-associated modulator, ATF7-interacting protein, ATF7, ATF

---

Product Information

14699-1-PBS targets ATF7IP in IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6341

  Product name: Recombinant human ATF7IP protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 756-1106 aa of BC063855

  Sequence: NTATVVATTQVPSGNPQPTISLQPLPVILHVPVAVSSQPQLLQSHPGTLVTNQPSGNVEFISVQSPPTVSGLTKNPVSLPSLPNPTKPNNVPSVPSPSIQRNPTASAAPLGTTLAVQAVPTAHSIVQATRTSLPTVGPSGLYSPSTNRGPIQMKIPISAFSTSSAAEQNSNTTPRIENQTNKTIDASVSKKAADSTSQCGKATGSDSSGVIDLTMDDEESGASQDPKKLNHTPVSTMSSSQPVSRPLQPIQPAPPLQPSGVPTSGPSQTTIHLLPTAPTTVNVTHRPVTQVTTRLPVPRAPANHQVVYTTLPAPPAQAPLRGTVMQAPAVRQVNPQNSKRFFLYMAPRYM

• Full Name: activating transcription factor 7 interacting protein
• Calculated Molecular Weight: 137 kDa
• GenBank Accession Number: BC063855
• Gene Symbol: ATF7IP
• Gene ID (NCBI): 55729
• RRID: AB_2878074
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q6VMQ6
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

ATF7IP (Activating Transcription Factor 7 Interacting Protein), also known as MCAF1 (MBD1-containing chromatin-associated factor 1), is a multifunctional scaffold protein that plays a pivotal role in epigenetic regulation and transcriptional control. Functionally, ATF7IP acts as an adaptor that recruits the histone methyltransferase SETDB1 to specific genomic loci, facilitating the deposition of the heterochromatin mark H3K9me3 and silencing target genes, including retrotransposons such as LINE1. This activity is essential for maintaining genomic stability by suppressing transposable element mobilization and preventing DNA damage.