• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated ATG4B Monoclonal antibody

ATG4B Monoclonal Antibody for IF/ICC
Cat No. CL488-67727
Clone No.1G5A7

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse, rat

Applications

IF/ICC

1G5A7, APG4B, AUTL1, AUT-like 1 cysteine endopeptidase, Autophagin-1

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-67727 targets ATG4B in IF/ICC applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag30510

Product name: Recombinant human ATG4B protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-393 aa of BC000719

Sequence: MDAATLTYDTLRFAEFEDFPETSEPVWILGRKYSIFTEKDEILSDVASRLWFTYRKNFPAIGGTGPTSDTGWGCMLRCGQMIFAQALVCRHLGRDWRWTQRKRQPDSYFSVLNAFIDRKDSYYSIHQIAQMGVGEGKSIGQWYGPNTVAQVLKKLAVFDTWSSLAVHIAMDNTVVMEEIRRLCRTSVPCAGATAFPADSDRHCNGFPAGAEVTNRPSPWRPLVLLIPLRLGLTDINEAYVETLKHCFMMPQSLGVIGGKPNSAHYFIGYVGEELIYLDPHTTQPAVEPTDGCFIPDESFHCQHPPCRMSIAELDPSIAVGFFCKTEDDFNDWCQQVKKLSLLGGALPMFELVEQQPSHLACPDVLNLSLDSSDVERLERFFDSEDEDFEILSL

Predict reactive species
Full Name ATG4 autophagy related 4 homolog B (S. cerevisiae)
Calculated Molecular Weight 44 kDa
Observed Molecular Weight44 kDa
GenBank Accession NumberBC000719
Gene Symbol ATG4B
Gene ID (NCBI) 23192
RRIDAB_3672961
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9Y4P1
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

ATG4B(autophagy 4) is also named as APG4B, AUTL1, KIAA0943 and belongs to the peptidase C54 family. It is a homolog of yeast Apg4, a cysteine protease involved in autophagy and is a cytoplasmic enzyme. This protein is highly expressed in skeletal muscle, with lower expression in heart, liver, and pancreas and no expression is detected in fetal tissues by the northern blot. ATG4B is widely expressed in tumor cell lines (PMID:12446702). It has some isoforms produced by alternative splicing with molecular mass of 31-52 kDa.

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 ATG4B antibody CL488-67727Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...