ATG4C Polyclonal antibody

• 

  WB analysis of Jurkat using 20382-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 20382-1-AP (ATG4C antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human heart using 20382-1-AP

  Immunohistochemical analysis of paraffin-embedded human heart using 20382-1-AP (ATG4C antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human heart using 20382-1-AP

  Immunohistochemical analysis of paraffin-embedded human heart using 20382-1-AP (ATG4C antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human testis using 20382-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis using 20382-1-AP (ATG4C antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human testis using 20382-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis using 20382-1-AP (ATG4C antibody) at dilution of 1:50 (under 40x lens).

• 

  IF Staining of HeLa using 20382-1-AP

  Immunofluorescent analysis of (-20°C Methanol) fixed HeLa cells using ATG4C antibody (20382-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L).

ATG4C Polyclonal Antibody for WB, IF, IHC, ELISA

Cat No. 20382-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IF, IHC, ELISA

Synonyms

APG4 C, APG4C, ATG4C, AUTL1, AUTL3, Autophagin 3, Cysteine protease ATG4C

---

Tested Applications

• Positive WB detected in: Jurkat cells
• Positive IHC detected in: human heart tissue, human testis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:200-1:1000
• Immunohistochemistry (IHC): IHC : 1:20-1:200
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 2 publications below

Product Information

20382-1-AP targets ATG4C in WB, IF, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14207

  Product name: Recombinant human ATG4C protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-300 aa of BC033024

  Sequence: MEATGTDEVDKLKTKFISAWNNMKYSWVLKTKTYFSRNSPVLLLGKCYHFKYEDEDKTLPAESGCTIEDHVIAGNVEEFRKDFISRIWLTYREEFPQIEGSALTTDCGWGCTLRTGQMLLAQGLILHFLGRAWTWPDALNIENSDSESWTSHTVKKFTASFEASLSGEREFKTPTISLKETIGKYSDDHEMRNEVYHRKIISWFGDSPLALFGLHQLIEYGKKSGKKAGDWYGPAVVAHILRKAVEEARHPDLQGITIYVAQDCTVYNSDVIDKQSASMTSDNADDKAVIILVPVRLGGE

• Full Name: ATG4 autophagy related 4 homolog C (S. cerevisiae)
• Calculated Molecular Weight: 458 aa, 52 kDa
• Observed Molecular Weight: 52-55 kDa
• GenBank Accession Number: BC033024
• Gene Symbol: ATG4C
• Gene ID (NCBI): 84938
• RRID: AB_10666852
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96DT6
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Autophagy; Analysis of ATG4C function in vivo; Authors - Isaac Tamargo-Gómez
human	WB	Theranostics; The c-Myc/miR-27b-3p/ATG10 regulatory axis regulates chemoresistance in colorectal cancer.; Authors - Wu Sun