CoraLite® Plus 488-conjugated ATIC Recombinant monoclonal antibody

• 

  IF Staining of HeLa using CL488-84798-5

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using CoraLite® Plus 488 ATIC antibody (CL488-84798-5, Clone: 242324C8 ) at dilution of 1:200.

ATIC Uni-rAb^® Recombinant Antibody for IF/ICC

Cat No. CL488-84798-5

Clone No.242324C8

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC

Synonyms

242324C8, 5-aminoimidazole-4-carboxamide ribonucleotide formyltransferase, AICAR, AICAR formyltransferase, AICAR transformylase/inosine monophosphate cyclohydrolase

---

Tested Applications

• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-84798-5 targets ATIC in IF/ICC applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag1052

  Product name: Recombinant human ATIC protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 291-592 aa of BC008879

  Sequence: DLYKTLTPISAAYARARGADRMSSFGDFVALSDVCDVPTAKIISREVSDGIIAPGYEEEALTILSKKKNGNYCVLQMDQSYKPDENEVRTLFGLHLSQKRNNGVVDKSLFSNVVTKNKDLPESALRDLIVATIAVKYTQSNSVCYAKNGQVIGIGAGQQSRIHCTRLAGDKANYWWLRHHPQVLSMKFKTGVKRAEISNAIDQYVTGTIGEDEDLIKWKALFEEVPELLTEAEKKEWVEKLTEVSISSDAFFPFRDNVDRAKRSGVAYIAAPSGSAADKVVIEACDELGIILAHTNLRLFHH

• Full Name: 5-aminoimidazole-4-carboxamide ribonucleotide formyltransferase/IMP cyclohydrolase
• Calculated Molecular Weight: 65 kDa
• Observed Molecular Weight: 62 kDa
• GenBank Accession Number: BC008879
• Gene Symbol: ATIC
• Gene ID (NCBI): 471
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P31939
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

5-Aminoimidazole-4-carboxamide ribonucleotide formyltransferase/IMP cyclohydrolase (ATIC, also known as AICAR) is an enzyme that can catalyze the last two reactions in the de novo purine biosynthetic pathway. It has been previously reported to be upregulated and to participate in myeloma and hepatocellular carcinoma progression (PMID: 35251351).