ATM Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 83608-5-RR (same clone as 83608-5-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 83608-5-RR (ATM antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 83608-5-PBS in a different storage buffer formulation.

• 

  WB analysis of A549 using 83608-5-RR (same clone as 83608-5-PBS)

  WB result of ATM antibody (83608-5-RR; 1:3000; room temperature for 1.5 hours) with wild-type and sg-ATM transfected A549 cells. This data was developed using the same antibody clone with 83608-5-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 83608-5-RR (same clone as 83608-5-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 83608-5-RR (ATM antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 83608-5-PBS in a different storage buffer formulation.

• 

  IF Staining of MCF-7 using 83608-5-RR (same clone as 83608-5-PBS)

  Immunofluorescent analysis of (4% PFA) fixed MCF-7 cells using ATM antibody (83608-5-RR, Clone: 240560F5 ) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 83608-5-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 83608-5-RR (same clone as 83608-5-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using ATM antibody (83608-5-RR, Clone: 240560F5 ) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 83608-5-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 83608-5-RR (same clone as 83608-5-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using ATM antibody (83608-5-RR, Clone: 240560F5 ) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 83608-5-PBS in a different storage buffer formulation.

• 

  FC experiment of MCF-7 using 83608-5-RR (same clone as 83608-5-PBS)

  1x10^6 MCF-7 cells were intracellularly stained with 0.25 ug ATM Recombinant antibody (83608-5-RR, Clone:240560F5) and APC-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L)(red), or 0.25 ug Isotype Control (blue). Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011). This data was developed using the same antibody clone with 83608-5-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 83608-5-RR

  Biolayer interferometry (BLl) kinetic assays of 83608-5-RR against Human ATM were performed. The affinity constant is 0.318 nM.

• Featured Product
• KD/KO Validated

ATM Uni-rAb^® Recombinant Antibody for WB, IHC, IF/ICC, FC (Intra), ELISA

Cat No. 83608-5-PBS

Clone No.240560F5

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, FC (Intra), ELISA

Synonyms

240560F5, A T mutated, A-T mutated, EC:2.7.11.1, Serine-protein kinase ATM

---

Product Information

83608-5-PBS targets ATM in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag25920

  Product name: Recombinant human ATM protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 1059-1361 aa of BC137169

  Sequence: SSEFENKQALLKRAKEEVGLLREHKIQTNRYTVKVQRELELDELALRALKEDRKRFLCKAVENYINCLLSGEEHDMWVFRLCSLWLENSGVSEVNGMMKRDGMKIPTYKFLPLMYQLAARMGTKMMGGLGFHEVLNNLISRISMDHPHHTLFIILALANANRDEFLTKPEVARRSRITKNVPKQSSQLDEDRTEAANRIICTIRSRRPQMVRSVEALCDAYIILANLDATQWKTQRKGINIPADQPITKLKNLEDVVVPTMEIKVDHTGEYGNLVTIQSFKAEFRLAGGVNLPKIIDCVGSDG

• Full Name: ataxia telangiectasia mutated
• Observed Molecular Weight: 310-350 kDa
• GenBank Accession Number: BC137169
• Gene Symbol: ATM
• Gene ID (NCBI): 472
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: Q13315
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

The ATM protein is a member of the phosphatidylinositol 3-kinase family of proteins that respond to DNA damage by phosphorylating key substrates involved in DNA repair and/or cell cycle control. It is involved in mitogenic signal transduction, meiotic recombination, detection of DNA damage, and cell cycle control.