ATP13A5 Polyclonal antibody

• 

  IHC staining of mouse kidney using 24676-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 24676-1-AP (ATP13A5 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse kidney using 24676-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 24676-1-AP (ATP13A5 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 24676-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 24676-1-AP (ATP13A5 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of rat brain using 24676-1-AP

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded rat brain tissue using ATP13A5 antibody (24676-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

ATP13A5 Polyclonal Antibody for IHC, IF-P, ELISA

Cat No. 24676-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IHC, IF-P, ELISA

Synonyms

ATPase type 13A5, P5 ATPase isoform 5

---

Tested Applications

• Positive IHC detected in: mouse kidney tissue, mouse brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: rat brain tissue

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

24676-1-AP targets ATP13A5 in IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag20337

  Product name: Recombinant human ATP13A5 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1123-1218 aa of BC156652

  Sequence: TQFCVAFFVEDSILQNHELWLLIKREFGFYSKSQYRTWQKKLAEDSTWPPINRTDYSGDGKNGFYINGGYESHEQIPKRKLKLGGQPTEQHFWARL

• Full Name: ATPase type 13A5
• Calculated Molecular Weight: 1218 aa, 137 kDa
• GenBank Accession Number: BC156652
• Gene Symbol: ATP13A5
• Gene ID (NCBI): 344905
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q4VNC0
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ATP13A5 is a member of the P5 subfamily of P-type transport ATPases. ATP13A5 functions within the intracellular membrane system and is mainly responsible for maintaining the ionic homeostasis and phospholipid balance of the intracellular membrane system.