Home
Products
Primary Antibodies
ATP13A5 Polyclonal antibody, PBS Only (24676-1-PBS)

Filter: AllIHCIF-P

IHC staining of mouse kidney using 24676-1-AP (same clone as 24676-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 24676-1-AP (ATP13A5 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 24676-1-PBS in a different storage buffer formulation.
IHC staining of mouse kidney using 24676-1-AP (same clone as 24676-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 24676-1-AP (ATP13A5 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 24676-1-PBS in a different storage buffer formulation.
IHC staining of mouse brain using 24676-1-AP (same clone as 24676-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 24676-1-AP (ATP13A5 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 24676-1-PBS in a different storage buffer formulation.
IF Staining of rat brain using 24676-1-AP (same clone as 24676-1-PBS)
Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded rat brain tissue using ATP13A5 antibody (24676-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 24676-1-PBS in a different storage buffer formulation.

ATP13A5 Polyclonal antibody, PBS Only

Name: ATP13A5 Polyclonal antibody, PBS Only
Brand: Proteintech
SKU: 24676-1-PBS

ATP13A5 Polyclonal Antibody for IHC, IF-P, Indirect ELISA

Cat No. 24676-1-PBS

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IHC, IF-P, Indirect ELISA

Synonyms

ATPase type 13A5, P5 ATPase isoform 5

Formulation: PBS Only

PBS, Azide, Glycerol

Conjugate: Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

24676-1-PBS targets ATP13A5 in IHC, IF-P, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag20337 Product name: Recombinant human ATP13A5 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1123-1218 aa of BC156652 Sequence: TQFCVAFFVEDSILQNHELWLLIKREFGFYSKSQYRTWQKKLAEDSTWPPINRTDYSGDGKNGFYINGGYESHEQIPKRKLKLGGQPTEQHFWARL Predict reactive species
Full Name	ATPase type 13A5
Calculated Molecular Weight	1218 aa, 137 kDa
GenBank Accession Number	BC156652
Gene Symbol	ATP13A5
Gene ID (NCBI)	344905
RRID	AB_3742121
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	Q4VNC0
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

ATP13A5 is a member of the P5 subfamily of P-type transport ATPases. ATP13A5 functions within the intracellular membrane system and is mainly responsible for maintaining the ionic homeostasis and phospholipid balance of the intracellular membrane system.