• Featured Product
  • KD/KO Validated

ATP1B3 Monoclonal antibody, PBS Only

ATP1B3 Monoclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA
Cat No. 67554-1-PBS
Clone No.1H9C1

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, IHC, IF/ICC, Indirect ELISA

1H9C1, ATPB 3, ATPB-3, CD298, Sodium/potassium-dependent ATPase subunit beta-3

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

67554-1-PBS targets ATP1B3 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag30127

Product name: Recombinant human ATP1B3 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 63-213 aa of BC011835

Sequence: QTLNDEVPKYRDQIPSPGLMVFPKPVTALEYTFSRSDPTSYAGYIEDLKKFLKPYTLEEQKNLTVCPDGALFEQKGPVYVACQFPISLLQACSGMNDPDFGYSQGNPCILVKMNRIIGLKPEGVPRIDCVSKNEDIPNVAVYPHNGMIDLK

Predict reactive species
Full Name ATPase, Na+/K+ transporting, beta 3 polypeptide
Calculated Molecular Weight 32 kDa
Observed Molecular Weight 32-43 kDa
GenBank Accession NumberBC011835
Gene Symbol ATP1B3
Gene ID (NCBI) 483
RRIDAB_2882768
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP54709
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

ATP1B3 (also known as CD298) is the β3 subunit of Na+/K+-ATPase which functions to maintain sodium and potassium gradients across membranes involved in cellular activities. ATP1B3 is a glycosylated protein and there are fully and intermediately glycosylated forms of ATP1B3 in mammalian cells. The predicted MW of ATP1B3 is around 32 kDa, while various forms (38-43 kDa) can be observed due to the different level of glycosylation (PMID: 30792309, 16339171, 17176442).

Loading...
||
New chat Able
正在加载,请稍候...