ATP2B1 Polyclonal antibody

• 

  WB analysis using 30035-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 30035-1-AP (ATP2B1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human colon using 30035-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 30035-1-AP (ATP2B1 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human pancreas cancer using 30035-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 30035-1-AP (ATP2B1 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

ATP2B1 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 30035-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

Human, mouse

Applications

WB, IHC, ELISA

Synonyms

ATP2B1, PMCA1, PMCA1kb

---

Tested Applications

• Positive WB detected in: 37°C incubated mouse brain tissue
• Positive IHC detected in: human pancreas cancer tissue, human colon tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• IHC: See 1 publications below

Product Information

30035-1-AP targets ATP2B1 in WB, IHC, ELISA applications and shows reactivity with Human, mouse samples.

• Tested Reactivity: Human, mouse
• Cited Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag32423

  Product name: Recombinant human ATP2B1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 2-89 aa of NM_001001323.1

  Sequence: GDMANNSVAYSGVKNSLKEANHDGDFGITLAELRALMELRSTDALRKIQESYGDVYGICTKLKTSPNEGLSGNPADLERREAVFGKNF

• Full Name: ATPase, Ca++ transporting, plasma membrane 1
• Calculated Molecular Weight: 135 kDa
• Observed Molecular Weight: 130-180 kDa
• GenBank Accession Number: NM_001001323.1
• Gene Symbol: ATP2B1
• Gene ID (NCBI): 490
• RRID: AB_3086214
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P20020
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ATPase plasma membrane Ca2+ transporting 1 (ATP2B1, also known as plasma membrane Ca2+ pump isoform 1; PMCA1) belongs to the family of ATP-driven calmodulin-dependent Ca2+ pumps that participate in the regulation of intracellular free Ca2+ (PMID:35358416). The ATP2B1 contents of extracellular vesicles are increased in prostate cancer treated with enzalutamide and are negatively regulated by androgen receptors (PMID:29105980). ATP2B1 plays an important role in the prognosis of cholangiocarcinoma. Furthermore, ATP2B1 plays an important role in the prognosis of cholangiocarcinoma and can be a prognostic factor for cholangiocarcinoma (PMID:35875160).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	IHC	Animal Model Exp Med; Age and gender effects on echocardiographic and histopathological cardiac phenotypes in healthy adult mice.; Authors - Shuang Wen