ATP2B1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• ATP2B1 Polyclonal antibody, PBS Only (30035-1-PBS)

• 

  WB analysis using 30035-1-AP (same clone as 30035-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 30035-1-AP (ATP2B1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 30035-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon using 30035-1-AP (same clone as 30035-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 30035-1-AP (ATP2B1 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 30035-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human pancreas cancer using 30035-1-AP (same clone as 30035-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 30035-1-AP (ATP2B1 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 30035-1-PBS in a different storage buffer formulation.

ATP2B1 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 30035-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

30035-1-PBS targets ATP2B1 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag32423

  Product name: Recombinant human ATP2B1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 2-89 aa of NM_001001323.1

  Sequence: GDMANNSVAYSGVKNSLKEANHDGDFGITLAELRALMELRSTDALRKIQESYGDVYGICTKLKTSPNEGLSGNPADLERREAVFGKNF

• Full Name: ATPase, Ca++ transporting, plasma membrane 1
• Calculated Molecular Weight: 135 kDa
• Observed Molecular Weight: 130-180 kDa
• GenBank Accession Number: NM_001001323.1
• Gene Symbol: ATP2B1
• Gene ID (NCBI): 490
• RRID: AB_3086214
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P20020
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

ATPase plasma membrane Ca2+ transporting 1 (ATP2B1, also known as plasma membrane Ca2+ pump isoform 1; PMCA1) belongs to the family of ATP-driven calmodulin-dependent Ca2+ pumps that participate in the regulation of intracellular free Ca2+ (PMID:35358416). The ATP2B1 contents of extracellular vesicles are increased in prostate cancer treated with enzalutamide and are negatively regulated by androgen receptors (PMID:29105980). ATP2B1 plays an important role in the prognosis of cholangiocarcinoma. Furthermore, ATP2B1 plays an important role in the prognosis of cholangiocarcinoma and can be a prognostic factor for cholangiocarcinoma (PMID:35875160).