CoraLite® Plus 488-conjugated ATP5I Recombinant monoclonal antibody

ATP5I Uni-rAb® Recombinant Antibody for IF/ICC
Cat No. CL488-86218-2
Clone No.250815C6

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC

ATP synthase membrane subunit e, ATP synthase subunit e, mitochondrial, N-terminally processed, ATP5K, ATP5ME, ATPase subunit e

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-86218-2 targets ATP5I in IF/ICC applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag9605

Product name: Recombinant human ATP5I protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-69 aa of BC003679

Sequence: MVPPVQVSPLIKLGRYSALFLGVAYGATRYNYLKPRAEEERRIAAEEKKKQDELKRIARELAEDDSILK

Predict reactive species
Full Name ATP synthase, H+ transporting, mitochondrial F0 complex, subunit E
Calculated Molecular Weight 69 aa, 8 kDa
Observed Molecular Weight 8 kDa
GenBank Accession NumberBC003679
Gene Symbol ATP5I
Gene ID (NCBI) 521
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP56385
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

ATP5I(ATP synthase subunit e) is also named as ATP5K and belongs to the ATPase e subunit family. The ATP5I gene encodes the e subunit of the mitochondrial ATP synthase Fo complex. Mitochondrial membrane ATP synthase(F1F0 ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. Antisense ATP5I in a human HCC cell line inhibited cell growth suggesting that ATP5I acts through the MAP kinase pathway(PMID:11939412).

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 ATP5I antibody CL488-86218-2Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...