ATP5O Monoclonal antibody, PBS Only

• 

  WB analysis using 66696-1-Ig (same clone as 66696-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 66696-1-Ig (ATP5O antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66696-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 66696-1-Ig (same clone as 66696-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 66696-1-Ig (ATP5O antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66696-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 66696-1-Ig (same clone as 66696-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 66696-1-Ig (ATP5O antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66696-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 66696-1-Ig (same clone as 66696-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 66696-1-Ig (ATP5O antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66696-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 66696-1-Ig (same clone as 66696-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 66696-1-Ig (ATP5O antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66696-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 66696-1-Ig (same clone as 66696-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 66696-1-Ig (ATP5O antibody) at dilution of 1:300 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66696-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 66696-1-Ig (same clone as 66696-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 66696-1-Ig (ATP5O antibody) at dilution of 1:300 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66696-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 66696-1-Ig (same clone as 66696-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using 66696-1-Ig (ATP5O antibody), at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 66696-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 66696-1-Ig (same clone as 66696-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using 66696-1-Ig (ATP5O antibody), at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 66696-1-PBS in a different storage buffer formulation.

ATP5O Monoclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 66696-1-PBS

Clone No.1D3B8

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

ATP5PO, 1D3B8, ATP synthase peripheral stalk subunit OSCP, ATPO, OSCP

---

Product Information

66696-1-PBS targets ATP5O in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1458

  Product name: Recombinant human ATP5O protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-213 aa of BC021233

  Sequence: MAAPAVSGLSRQVRCFSTSVVRPFAKLVRPPVQVYGIEGRYATALYSAASKQNKLEQVEKELLRVAQILKEPKVAASVLNPYVKRSIKVKSLNDITAKERFSPLTTNLINLLAENGRLSNTQGVVSAFSTMMSVHRGEVPCTVTSASPLEEATLSELKTVLKSFLSQGQVLKLEAKTDPSILGGMIVRIGEKYVDMSVKTKIQKLGRAMREIV

• Full Name: ATP synthase, H+ transporting, mitochondrial F1 complex, O subunit
• Calculated Molecular Weight: 23 kDa
• Observed Molecular Weight: 23-25 kDa
• GenBank Accession Number: BC021233
• Gene Symbol: ATP5O
• Gene ID (NCBI): 539
• RRID: AB_2882049
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P48047
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

ATP5O(ATP synthase subunit O, mitochondrial) is also named as ATPO, OSCP and belongs to the ATPase delta chain family. The gene encodes the oligomycin sensitivity-conferring protein (OSCP) of ATP synthase. The predicted polypeptide is 213 amino acids long with more than 80% identity to the bovine and mouse homologs and it is expressed at highest levels in muscle and heart by the northern blot(PMID:7490082). Many studies have indicated that mitochondrial dysfunction is central to the development of most age-related human diseases including neurodegenerative diseases, cancer, and type 2 diabetes.