ATP5SL Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• ATP5SL Polyclonal antibody, PBS Only (23866-1-PBS)

• 

  WB analysis using 23866-1-AP (same clone as 23866-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 23866-1-AP (ATP5SL antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 23866-1-PBS in a different storage buffer formulation.

ATP5SL Polyclonal Antibody for WB, Indirect ELISA

Cat No. 23866-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

23866-1-PBS targets ATP5SL in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag20909

  Product name: Recombinant human ATP5SL protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 1-158 aa of BC013323

  Sequence: MAAPWASLRLVAPMWNGRIRGIHRLGAAVAPEGNQKKKRTILQFLTNYFYDVEALRDYLLQREMYKVHEKNRFRDKEWIRPDKYGHFSQEFWNFCEVPVEAVDAGDCDINYEGLDNLRTSAGWTSRTSLPCPTLASLRYWWRRCCPIARLWESTGLRA

• Full Name: ATP5S-like
• Calculated Molecular Weight: 158 aa, 19 kDa
• Observed Molecular Weight: 29-32 kDa
• GenBank Accession Number: BC013323
• Gene Symbol: ATP5SL
• Gene ID (NCBI): 55101
• RRID: AB_3669421
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen Affinity purified
• UNIPROT ID: Q9NW81
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.