ATP6V0D1 Monoclonal antibody, PBS Only

• 

  WB analysis using 68506-1-Ig (same clone as 68506-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 68506-1-Ig (ATP6V0D1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68506-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HeLa using 68506-1-Ig (same clone as 68506-1-PBS)

  IP result of anti-ATP6V0D1 (IP:68506-1-Ig, 4ug; Detection:68506-1-Ig 1:3000) with HeLa cells lysate 1520 ug. This data was developed using the same antibody clone with 68506-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse kidney using 68506-1-Ig (same clone as 68506-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 68506-1-Ig (ATP6V0D1 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 68506-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse kidney using 68506-1-Ig (same clone as 68506-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 68506-1-Ig (ATP6V0D1 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 68506-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 68506-1-Ig (same clone as 68506-1-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed HeLa cells using ATP6V0D1 antibody (68506-1-Ig, Clone: 1G7A12 ) at dilution of 1:2400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 68506-1-PBS in a different storage buffer formulation.

ATP6V0D1 Monoclonal Antibody for WB, IHC, IF/ICC, IP, Indirect ELISA

Cat No. 68506-1-PBS

Clone No.1G7A12

Host / Isotype

Mouse / IgG1

Reactivity

Human, Mouse, Rat, Pig, Rabbit, Chicken, Zebrafish

Applications

WB, IHC, IF/ICC, IP, Indirect ELISA

Synonyms

32 kDa accessory protein, ATP6D, ATP6DV, ATP6V0D1, P39, V ATPase AC39 subunit, V ATPase subunit d 1, VATX, VMA6, VPATPD

---

Product Information

68506-1-PBS targets ATP6V0D1 in WB, IHC, IF/ICC, IP, Indirect ELISA applications and shows reactivity with Human, Mouse, Rat, Pig, Rabbit, Chicken, Zebrafish samples.

• Tested Reactivity: Human, Mouse, Rat, Pig, Rabbit, Chicken, Zebrafish
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13012

  Product name: Recombinant human ATP6V0D1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-351 aa of BC008861

  Sequence: MSFFPELYFNVDNGYLEGLVRGLKAGVLSQADYLNLVQCETLEDLKLHLQSTDYGNFLANEASPLTVSVIDDRLKEKMVVEFRHMRNHAYEPLASFLDFITYSYMIDNVILLITGTLHQRSIAELVPKCHPLGSFEQMEAVNIAQTPAELYNAILVDTPLAAFFQDCISEQDLDEMNIEIIRNTLYKAYLESFYKFCTLLGGTTADAMCPILEFEADRRAFIITINSFGTELSKEDRAKLFPHCGRLYPEGLAQLARADDYEQVKNVADYYPEYKLLFEGAGSNPGDKTLEDRFFEHEVKLNKLAFLNQFHFGVFYAFVKLKEQECRNIVWIAECIAQRHRAKIDNYIPIF

• Full Name: ATPase, H+ transporting, lysosomal 38kDa, V0 subunit d1
• Calculated Molecular Weight: 351 aa, 40 kDa
• Observed Molecular Weight: 37-41 kDa
• GenBank Accession Number: BC008861
• Gene Symbol: ATP6V0D1
• Gene ID (NCBI): 9114
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P61421
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

ATP6V0D1(V-type proton ATPase subunit d 1) is also named as ATP6D, VPATPD and belongs to the V-ATPase V0D/AC39 subunit family.It is responsible for acidifying a variety of intracellular compartments in eukaryotic cells, thus providing most of the energy required for transport processes in the vacuolar system.