ATP6V1C1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• ATP6V1C1 Polyclonal antibody (16054-1-AP)

ATP6V1C1 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 16054-1-AP Copied!

Publications (13)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, ELISA

Synonyms

ATP6C, ATP6D, VATC, V-ATPase subunit C 1, Vma5

• 

  WB analysis of NIH/3T3 using 16054-1-AP

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 16054-1-AP (ATP6V1C1 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 16054-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 16054-1-AP (ATP6V1C1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human brain using 16054-1-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 16054-1-AP (ATP6V1C1 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human testis using 16054-1-AP

  human testis tissue were subjected to SDS PAGE followed by western blot with 16054-1-AP (ATP6V1C1 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse brain using 16054-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 16054-1-AP (ATP6V1C1 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse brain using 16054-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 16054-1-AP (ATP6V1C1 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for ATP6V1C1 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HeLa cells, NIH/3T3 cells, human brain tissue, human testis tissue, mouse brain tissue, rat brain tissue
• Positive IHC detected in: mouse brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunohistochemistry (IHC): IHC : 1:250-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

16054-1-AP targets ATP6V1C1 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9020

  Product name: Recombinant human ATP6V1C1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-381 aa of BC010960

  Sequence: MTEFWLISAPGEKTCQQTWEKLHAATSKNNNLAVTSKFNIPDLKVGTLDVLVGLSDELAKLDAFVEGVVKKVAQYMADVLEDSKDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLKNISEIIAKGVTQIDNDLKSRASAYNNLKGNLQNLERKNAGSLLTRSLAEIVKKDDFVLDSEYLVTLLVVVPKLNHNDWIKQYETLAEMVVPRSSNVLSEDQDSYLCNVTLFRKAVDDFRHKARENKFIVRDFQYNEEEMKADKEEMNRLSTDKKKQFGPLVRWLKVNFSEAFIAWIHVKALRVFVESVLRYGLPVNFQAMLLQPNKKTLKKLREVLHELYKHLDSSAAAIIDAPMDIPGLNLSQQEYYPYVYYKIDCNLLEF

• Full Name: ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C1
• Calculated Molecular Weight: 382 aa, 44 kDa
• Observed Molecular Weight: 42-44 kDa
• GenBank Accession Number: BC010960
• Gene Symbol: ATP6V1C1
• Gene ID (NCBI): 528
• RRID: AB_2062501
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P21283
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The vacuolar H+-ATPase (V-ATPase) is a functionally conserved multimeric complex localized at the membranes of many organelles where its proton-pumping action is required for proper lumen acidification (PMID: 39210597). ATP6V1C1, also known as ATPase, H+ transporting, lysosomal V1 subunit C1, is a component of the V1 sector of the V-ATPase complex. ATP6v1c1 knockdown significantly reduces tumor stimulated bone resorption through osteoclastogenesis at the bone and metastasis in vivo, as well as V-ATPase activity, proliferation, and mTORC1 activation in vitro (PMID: 28504970). Also, ATP6V1C1, associated with the tumor microenvironment and mTORC1 signaling pathway, is a potential diagnostic, prognostic, and therapeutic biomarker for hepatocellular carcinoma () (PMID: 39557733).

Publications

What published studies show

The ATP6V1C1 Polyclonal antibody (Cat# 16054-1-AP) has 13 citations. Journals include Nature, Autophagy, Nat Struct Mol Biol, Mol Ther, Proc Natl Acad Sci U S A, Cell Rep, Commun Biol, J Biol Chem, JBMR Plus, Discov Oncol, Biochem Biophys Res Commun, Bioengineered, and bioRxiv. Research fields span autophagy, lysosomal biology, V-ATPase structure, cancer (glioblastoma, hepatocellular carcinoma, lung adenocarcinoma), ferroptosis, bone remodeling, and lysosomal stress signaling.

Automatically generated from the 13 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Autophagy; Inhibition of autophagy and induction of glioblastoma cell death by NEO214, a perillyl alcohol-rolipram conjugate; Authors - Mengting Ou
human	WB	Mol Ther; Caspase-8 Induces Lysosome-Associated Cell Death in Cancer Cells.; Authors - Benfu Zhong
human	WB	Nat Struct Mol Biol; A heterotrimeric protein complex assembles the metazoan V-ATPase upon dissipation of proton gradients; Authors - Christopher Nardone
	WB	Proc Natl Acad Sci U S A; Oxr1 and Ncoa7 regulate V-ATPase to achieve optimal pH for glycosylation within the Golgi apparatus and trans-Golgi network; Authors - Shin-Ichiro Yoshimura
		Cell Rep; Cancer-associated fibroblast-derived extracellular vesicles deliver ATP6V1C1 to promote lung adenocarcinoma metastasis via the ID1-IGFBP3 axis.; Authors - Xuanming Chen
human	WB	Commun Biol; A substrate-trapping strategy to find E3 ubiquitin ligase substrates identifies Parkin and TRIM28 targets.; Authors - Masashi Watanabe