Product Information
17725-1-PBS targets ATP6V1F in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag12121 Product name: Recombinant human ATP6V1F protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-119 aa of BC107854 Sequence: MAGRGKLIAVIGDEDTVTGFLLGGIGELNKNRHPNFLVVEKDTTINEIEDTFRQFLNRDDIGIILINQYIAEMVRHALDAHQQSIPAVLEIPSKEHPYDAAKDSILRRARGMFTAEDLR Predict reactive species |
| Full Name | ATPase, H+ transporting, lysosomal 14kDa, V1 subunit F |
| Calculated Molecular Weight | 119 aa, 13 kDa |
| Observed Molecular Weight | 14 kDa |
| GenBank Accession Number | BC107854 |
| Gene Symbol | ATP6V1F |
| Gene ID (NCBI) | 9296 |
| RRID | AB_2062680 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q16864 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
ATP6V1F(V-type proton ATPase subunit F) is also named as ATP6S14, VATF and belongs to the V-ATPase F subunit family. It generates an electrochemical proton gradient that is acid and positive inside synaptic vesicles. ATP6V1F plays a major role as energizers of animal plasma membranes, especially apical plasma membranes of epithelial cells. This protein has 2 isoforms produced by alternative splicing with the molecular weight of 14 kDa and 16 kDa.





























