Home
Products
Primary Antibodies
ATP6V1F Polyclonal antibody, PBS Only (17725-1-PBS)

Filter: AllWBIHC

WB analysis of MCF-7 using 17725-1-AP (same clone as 17725-1-PBS)
MCF7 cells were subjected to SDS PAGE followed by western blot with 17725-1-AP (ATP6V1F antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17725-1-PBS in a different storage buffer formulation.
WB analysis of HeLa using 17725-1-AP (same clone as 17725-1-PBS)
HeLa cells were subjected to SDS PAGE followed by western blot with 17725-1-AP (ATP6V1F antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17725-1-PBS in a different storage buffer formulation.
WB analysis of Jurkat using 17725-1-AP (same clone as 17725-1-PBS)
Jurkat cells were subjected to SDS PAGE followed by western blot with 17725-1-AP (ATP6V1F antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17725-1-PBS in a different storage buffer formulation.
WB analysis of mouse skeletal muscle using 17725-1-AP (same clone as 17725-1-PBS)
mouse skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 17725-1-AP (ATP6V1F antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17725-1-PBS in a different storage buffer formulation.
WB analysis of mouse liver using 17725-1-AP (same clone as 17725-1-PBS)
mouse liver tissue were subjected to SDS PAGE followed by western blot with 17725-1-AP (ATP6V1F antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17725-1-PBS in a different storage buffer formulation.
IHC staining of human testis using 17725-1-AP (same clone as 17725-1-PBS)
Immunohistochemical analysis of paraffin-embedded human testis using 17725-1-AP (ATP6V1F antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 17725-1-PBS in a different storage buffer formulation.
IHC staining of human testis using 17725-1-AP (same clone as 17725-1-PBS)
Immunohistochemical analysis of paraffin-embedded human testis using 17725-1-AP (ATP6V1F antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 17725-1-PBS in a different storage buffer formulation.
IHC staining of human brain using 17725-1-AP (same clone as 17725-1-PBS)
Immunohistochemical analysis of paraffin-embedded human brain using 17725-1-AP (ATP6V1F antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 17725-1-PBS in a different storage buffer formulation.
IHC staining of human brain using 17725-1-AP (same clone as 17725-1-PBS)
Immunohistochemical analysis of paraffin-embedded human brain using 17725-1-AP (ATP6V1F antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 17725-1-PBS in a different storage buffer formulation.
IHC staining of human pancreas using 17725-1-AP (same clone as 17725-1-PBS)
Immunohistochemical analysis of paraffin-embedded human pancreas tissue slide using 17725-1-AP (ATP6V1F Antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 17725-1-PBS in a different storage buffer formulation.
IHC staining of human pancreas using 17725-1-AP (same clone as 17725-1-PBS)
Immunohistochemical analysis of paraffin-embedded human pancreas tissue slide using 17725-1-AP (ATP6V1F Antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 17725-1-PBS in a different storage buffer formulation.
IHC staining of human kidney using 17725-1-AP (same clone as 17725-1-PBS)
Immunohistochemical analysis of paraffin-embedded human kidney using 17725-1-AP (ATP6V1F antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 17725-1-PBS in a different storage buffer formulation.
IHC staining of human kidney using 17725-1-AP (same clone as 17725-1-PBS)
Immunohistochemical analysis of paraffin-embedded human kidney using 17725-1-AP (ATP6V1F antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 17725-1-PBS in a different storage buffer formulation.
IHC staining of human placenta using 17725-1-AP (same clone as 17725-1-PBS)
Immunohistochemical analysis of paraffin-embedded human placenta using 17725-1-AP (ATP6V1F antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 17725-1-PBS in a different storage buffer formulation.
IHC staining of human placenta using 17725-1-AP (same clone as 17725-1-PBS)
Immunohistochemical analysis of paraffin-embedded human placenta using 17725-1-AP (ATP6V1F antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 17725-1-PBS in a different storage buffer formulation.

ATP6V1F Polyclonal antibody, PBS Only

Name: ATP6V1F Polyclonal antibody, PBS Only
Brand: Proteintech
SKU: 17725-1-PBS

ATP6V1F Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 17725-1-PBS

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, Indirect ELISA

Synonyms

Formulation: PBS Only

PBS, Azide, Glycerol

Conjugate: Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

17725-1-PBS targets ATP6V1F in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity	human, mouse
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag12121 Product name: Recombinant human ATP6V1F protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-119 aa of BC107854 Sequence: MAGRGKLIAVIGDEDTVTGFLLGGIGELNKNRHPNFLVVEKDTTINEIEDTFRQFLNRDDIGIILINQYIAEMVRHALDAHQQSIPAVLEIPSKEHPYDAAKDSILRRARGMFTAEDLR Predict reactive species
Full Name	ATPase, H+ transporting, lysosomal 14kDa, V1 subunit F
Calculated Molecular Weight	119 aa, 13 kDa
Observed Molecular Weight	14 kDa
GenBank Accession Number	BC107854
Gene Symbol	ATP6V1F
Gene ID (NCBI)	9296
RRID	AB_2062680
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	Q16864
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

ATP6V1F(V-type proton ATPase subunit F) is also named as ATP6S14, VATF and belongs to the V-ATPase F subunit family. It generates an electrochemical proton gradient that is acid and positive inside synaptic vesicles. ATP6V1F plays a major role as energizers of animal plasma membranes, especially apical plasma membranes of epithelial cells. This protein has 2 isoforms produced by alternative splicing with the molecular weight of 14 kDa and 16 kDa.