Filter: AllWBIHC

WB analysis using 25316-1-AP (same clone as 25316-1-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 25316-1-AP (ATP6V1G2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25316-1-PBS in a different storage buffer formulation.
IHC staining of mouse brain using 25316-1-AP (same clone as 25316-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 25316-1-AP (ATP6V1G2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 25316-1-PBS in a different storage buffer formulation.
IHC staining of mouse brain using 25316-1-AP (same clone as 25316-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 25316-1-AP (ATP6V1G2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 25316-1-PBS in a different storage buffer formulation.

ATP6V1G2 Polyclonal antibody, PBS Only

Name: ATP6V1G2 Polyclonal antibody, PBS Only
Brand: Proteintech
SKU: 25316-1-PBS

ATP6V1G2 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 25316-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

ATP6G, ATP6G2, ATP6V1G 2, NG38, V ATPase 13 kDa subunit 2

Formulation: PBS Only

PBS, Azide, Glycerol

Conjugate: Unconjugated

Size/Concentration:

Freight/Packing: -

Quantity

- +

25316-1-PBS targets ATP6V1G2 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag18007 Product name: Recombinant human ATP6V1G2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 40-118 aa of BC119726 Sequence: AQMEVEQYRREREHEFQSKQQAAMGSQGNLSAEVEQATRRQVQGMQSSQQRNRERVLAQLLGMVCDVRPQVHPNYRISA Predict reactive species
Full Name	ATPase, H+ transporting, lysosomal 13kDa, V1 subunit G2
Calculated Molecular Weight	118 aa, 14 kDa
Observed Molecular Weight	14 kDa
GenBank Accession Number	BC119726
Gene Symbol	ATP6V1G2
Gene ID (NCBI)	534
RRID	AB_2880027
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	O95670
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Able™