ATPAF1 Polyclonal antibody

ATPAF1 Polyclonal Antibody for WB, IHC, ELISA
Cat No. 18016-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

ATP11p, ATP11 homolog, ATP11

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHEK-293 cells, PC-3 cells, mouse heart tissue, mouse kidney tissue, rat heart tissue,
Positive IHC detected inhuman ovary cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:4000
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

WBSee 4 publications below

Product Information

18016-1-AP targets ATPAF1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag12557

Product name: Recombinant human ATPAF1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 25-328 aa of BC071731

Sequence: GLCAVRSRALGLGLVSPAQLRVFPVRPGSGRPEGGADGSGVGAEAELQANPFYDRYRDKIQLLRRSDPAAFESRLEKRSEFRKQPVGHSRQGDFIKCVEQKTDALGKQSVNRGFTKDKTLSSIFNIEMVKEKTAEEIKQIWQQYFAAKDTVYAVIPAEKFDLIWNRAQSCPTFLCALPRREGYEFFVGQWTGTELHFTALINIQTRGEAAASQLILYHYPELKEEKGIVLMTAEMDSTFLNVAEAQCIANQVQLFYATDRKETYGLVETFNLRPNEFKYMSVIAELEQSGLGAELKCAQNQNKT

Predict reactive species
Full Name ATP synthase mitochondrial F1 complex assembly factor 1
Calculated Molecular Weight 328 aa, 36 kDa
Observed Molecular Weight 31 kDa
GenBank Accession NumberBC071731
Gene Symbol ATPAF1
Gene ID (NCBI) 64756
RRIDAB_2243352
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ5TC12
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Protocols

Product Specific Protocols
IHC protocol for ATPAF1 antibody 18016-1-APDownload protocol
WB protocol for ATPAF1 antibody 18016-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Int J Mol Sci

CA9 Silencing Promotes Mitochondrial Biogenesis, Increases Putrescine Toxicity and Decreases Cell Motility to Suppress ccRCC Progression.

Authors - Jiatong Xu
mouseWB

Am J Physiol Endocrinol Metab

Exogenous H2S reduces acetylation levels of mitochondrial respiratory enzymes via regulating NAD+-SIRT3 pathway in cardiac tissues of db/db mice.

Authors - Yu Sun
humanWB

Metabolism

FAM3A maintains metabolic homeostasis by interacting with F1-ATP synthase to regulate the activity and assembly of ATP synthase

Authors - Han Yan
humanWB

iScience

Deficient tRNA posttranscription modification dysregulated the mitochondrial quality controls and apoptosis

Authors - Yunfan He
Loading...
||
New chat Able
正在加载,请稍候...