ATPAF1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• ATPAF1 Polyclonal antibody (18016-1-AP)

ATPAF1 Polyclonal Antibody for WB, IHC, IF-P, ELISA

Cat No. 18016-1-AP Copied!

Publications (6)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, ELISA

Synonyms

ATP11, ATP11 homolog, ATP11p

• 

  WB analysis using 18016-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 18016-1-AP (ATPAF1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human ovary cancer using 18016-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 18016-1-AP (ATPAF1 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of mouse brain using 18016-1-AP

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse brain tissue using ATPAF1 antibody (18016-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for ATPAF1 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HEK-293 cells, PC-3 cells, mouse heart tissue, mouse kidney tissue, rat heart tissue,
• Positive IHC detected in: human ovary cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: mouse brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:4000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)-P: IF-P : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

18016-1-AP targets ATPAF1 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12557

  Product name: Recombinant human ATPAF1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 25-328 aa of BC071731

  Sequence: GLCAVRSRALGLGLVSPAQLRVFPVRPGSGRPEGGADGSGVGAEAELQANPFYDRYRDKIQLLRRSDPAAFESRLEKRSEFRKQPVGHSRQGDFIKCVEQKTDALGKQSVNRGFTKDKTLSSIFNIEMVKEKTAEEIKQIWQQYFAAKDTVYAVIPAEKFDLIWNRAQSCPTFLCALPRREGYEFFVGQWTGTELHFTALINIQTRGEAAASQLILYHYPELKEEKGIVLMTAEMDSTFLNVAEAQCIANQVQLFYATDRKETYGLVETFNLRPNEFKYMSVIAELEQSGLGAELKCAQNQNKT

• Full Name: ATP synthase mitochondrial F1 complex assembly factor 1
• Calculated Molecular Weight: 328 aa, 36 kDa
• Observed Molecular Weight: 31 kDa
• GenBank Accession Number: BC071731
• Gene Symbol: ATPAF1
• Gene ID (NCBI): 64756
• RRID: AB_2243352
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q5TC12
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The ATPAF1 Polyclonal antibody (Cat# 18016-1-AP) has 6 citations published in Metabolism, Cell Death & Disease, EMBO Journal, International Journal of Molecular Sciences, iScience, and American Journal of Physiology – Endocrinology and Metabolism. Research fields span ATP synthase structure and function, mitochondrial biogenesis, metabolic homeostasis, chemotherapy resistance in acute myeloid leukemia, renal cell carcinoma progression, tRNA modification–related mitochondrial quality control, and cardiac SIRT3-mediated deacetylation.

Automatically generated from the 6 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Metabolism; FAM3A maintains metabolic homeostasis by interacting with F1-ATP synthase to regulate the activity and assembly of ATP synthase; Authors - Han Yan
human	WB	Cell Death Dis; The ALDH2/PolG2 axis enhances mitochondrial biogenesis via transcriptional regulation of Nrf2 and promotes chemotherapy resistance in acute myeloid leukaemia.; Authors - Xiuying Hu
		EMBO J; Assembly of the catalytic module and the rotor of human ATP synthase.; Authors - Jiaya He
human	WB	Int J Mol Sci; CA9 Silencing Promotes Mitochondrial Biogenesis, Increases Putrescine Toxicity and Decreases Cell Motility to Suppress ccRCC Progression.; Authors - Jiatong Xu
human	WB	iScience; Deficient tRNA posttranscription modification dysregulated the mitochondrial quality controls and apoptosis; Authors - Yunfan He
mouse	WB	Am J Physiol Endocrinol Metab; Exogenous H2S reduces acetylation levels of mitochondrial respiratory enzymes via regulating NAD+-SIRT3 pathway in cardiac tissues of db/db mice.; Authors - Yu Sun