ATPB Monoclonal antibody, PBS Only

• 

  WB analysis using 66600-1-Ig (same clone as 66600-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 66600-1-Ig (ATPB antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66600-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 66600-1-Ig (same clone as 66600-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 66600-1-Ig (ATPB antibody) at dilution of 1:500 (under 10x lens). This data was developed using the same antibody clone with 66600-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 66600-1-Ig (same clone as 66600-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 66600-1-Ig (ATPB antibody) at dilution of 1:500 (under 40x lens). This data was developed using the same antibody clone with 66600-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse skeletal muscle using 66600-1-Ig (same clone as 66600-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse skeletal muscle tissue slide using 66600-1-Ig (ATPB antibody) at dilution of 1:500 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66600-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse skeletal muscle using 66600-1-Ig (same clone as 66600-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse skeletal muscle tissue slide using 66600-1-Ig (ATPB antibody) at dilution of 1:500 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66600-1-PBS in a different storage buffer formulation.

• 

  IF Staining of U2OS using 66600-1-Ig (same clone as 66600-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed U2OS cells using ATPB antibody (66600-1-Ig, Clone: 1A11B9 ) at dilution of 1:800 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) (SA00013-1), CL594-phalloidin (red). This data was developed using the same antibody clone with 66600-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 66600-1-Ig (same clone as 66600-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using ATPB antibody (66600-1-Ig, Clone: 1A11B9 ) at dilution of 1:1000 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L) (SA00013-1), CL594-Phalloidin (red). This data was developed using the same antibody clone with 66600-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 66600-1-Ig (same clone as 66600-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using ATPB antibody (66600-1-Ig, Clone: 1A11B9 ) at dilution of 1:1000 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L) (SA00013-1), CL594-Phalloidin (red). This data was developed using the same antibody clone with 66600-1-PBS in a different storage buffer formulation.

ATPB Monoclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 66600-1-PBS

Clone No.1A11B9

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

1A11B9, ATP synthase F1 subunit beta, ATP5B, ATP5F1B, ATPMB

---

Product Information

66600-1-PBS targets ATPB in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag11177

  Product name: Recombinant human ATPB protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 181-529 aa of BC016512

  Sequence: EILVTGIKVVDLLAPYAKGGKIGLFGGAGVGKTVLIMELINNVAKAHGGYSVFAGVGERTREGNDLYHEMIESGVINLKDATSKVALVYGQMNEPPGARARVALTGLTVAEYFRDQEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGTMQERITTTKKGSITSVQAIYVPADDLTDPAPATTFAHLDATTVLSRAIAELGIYPAVDPLDSTSRIMDPNIVGSEHYDVARGVQKILQDYKSLQDIIAILGMDELSEEDKLTVSRARKIQRFLSQPFQVAEVFTGHMGKLVPLKETIKGFQQILAGEYDHLPEQAFYMVGPIEEAVAKADKLAEEHSS

• Full Name: ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide
• Calculated Molecular Weight: 529 aa, 57 kDa
• Observed Molecular Weight: 45-57 kDa
• GenBank Accession Number: BC016512
• Gene Symbol: ATPB
• Gene ID (NCBI): 506
• RRID: AB_2881960
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P06576
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

ATP5B, also named as ATPMB and ATPSB, belongs to the ATPase alpha/beta chains family. It is a high affinity HDL receptor for apolipoprotein A1. ATP5B is a subunit of mitochondrial ATP synthase (F1F0 ATP synthase or Complex V ). ATP5B has a calculated molecular mass of 57 kDa and ~5 kDa transit peptide can be removed in the mature form.