Use Able AI chat for product recommendations

ATPB Monoclonal antibody

ATPB Monoclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 66600-1-Ig
Clone No. 1A11B9
Publications (4)
Review Product
Download datasheet

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA
For FC, select conjugated version.

1A11B9, ATP synthase F1 subunit beta, ATP5B, ATP5F1B, ATPMB

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for ATPB in ?

Tested Applications

Positive WB detected inHeLa cells, HEK-293 cells, HepG2 cells, Jurkat cells, HSCT6 cells, Raw 264.7 cells, NIH/3T3 cells
Positive IHC detected inhuman liver tissue, mouse skeletal muscle tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHepG2 cells, U2OS cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:250-1:1000
Immunofluorescence (IF)/ICCIF/ICC : 1:500-1:2000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

66600-1-Ig targets ATPB in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag11177

Product name: Recombinant human ATPB protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 181-529 aa of BC016512

Sequence: EILVTGIKVVDLLAPYAKGGKIGLFGGAGVGKTVLIMELINNVAKAHGGYSVFAGVGERTREGNDLYHEMIESGVINLKDATSKVALVYGQMNEPPGARARVALTGLTVAEYFRDQEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGTMQERITTTKKGSITSVQAIYVPADDLTDPAPATTFAHLDATTVLSRAIAELGIYPAVDPLDSTSRIMDPNIVGSEHYDVARGVQKILQDYKSLQDIIAILGMDELSEEDKLTVSRARKIQRFLSQPFQVAEVFTGHMGKLVPLKETIKGFQQILAGEYDHLPEQAFYMVGPIEEAVAKADKLAEEHSS

Predict reactive species
Full Name ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide
Calculated Molecular Weight 529 aa, 57 kDa
Observed Molecular Weight45-57 kDa
GenBank Accession NumberBC016512
Gene Symbol ATPB
Gene ID (NCBI) 506
RRIDAB_2881960
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP06576
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ATP5B, also named as ATPMB and ATPSB, belongs to the ATPase alpha/beta chains family. It is a high affinity HDL receptor for apolipoprotein A1. ATP5B is a subunit of mitochondrial ATP synthase (F1F0 ATP synthase or Complex V ). ATP5B has a calculated molecular mass of 57 kDa and ~5 kDa transit peptide can be removed in the mature form.

Protocols

Product Specific Protocols
IF protocol for ATPB antibody 66600-1-IgDownload protocol
IHC protocol for ATPB antibody 66600-1-IgDownload protocol
WB protocol for ATPB antibody 66600-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The ATPB Monoclonal antibody (1A11B9) (Cat# 66600-1-Ig) has 4 citations across four journals: Metabolism, Acta Pharmaceutica Sinica B, Molecular Metabolism, and Cell Biology International. The associated research fields include cerebral energy metabolism and stroke protection, methamphetamine addiction and ATP signaling, mitochondrial pyruvate uptake in the brain, and mitochondrial function in cardiomyoblasts exposed to photodamage. All cited applications were Western blot in mouse, human, or rat samples.

SpeciesApplicationTitle
mouseWB

Metabolism

Protein kinase N1 deficiency results in upregulation of cerebral energy metabolism and is highly protective in in vivo and in vitro stroke models

Authors - Stephanie Zur Nedden
mouseWB

Acta Pharm Sin B

Cannabidiol alleviates methamphetamine addiction via targeting ATP5A1 and modulating the ATP-ADO-A1R signaling pathway.

Authors - Sha Jin
humanWB

Mol Metab

Glucose-1,6-bisphosphate: a new gatekeeper of cerebral mitochondrial pyruvate uptake

Authors - Motahareh Solina Safari
ratWB

Cell Biol Int

The effect of all-trans retinoic acid on the mitochondrial function and survival of cardiomyoblasts exposed to local photodamage

Authors - Simona Kurekova
Loading...
||
New chat

Able™

正在加载,请稍候...