ATPBD3 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• ATPBD3 Polyclonal antibody, PBS Only (31537-1-PBS)

• 

  WB analysis using 31537-1-AP (same clone as 31537-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 31537-1-AP (ATPBD3 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 31537-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse kidney using 31537-1-AP (same clone as 31537-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 31537-1-AP (ATPBD3 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 31537-1-PBS in a different storage buffer formulation.

• 

  IF Staining of PC-3 using 31537-1-AP (same clone as 31537-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed PC-3 cells using ATPBD3 antibody (31537-1-AP) at dilution of 1:400 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002). This data was developed using the same antibody clone with 31537-1-PBS in a different storage buffer formulation.

ATPBD3 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 31537-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

NCS6, CTU1

---

Product Information

31537-1-PBS targets ATPBD3 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag35037

  Product name: Recombinant human ATPBD3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 50-200 aa of NM_145232

  Sequence: PGAVVAVGASGGKDSTVLAHVLRALAPRLGISLQLVAVDEGIGGYRDAALAAVRRQAARWELPLTVVAYEDLFGGWTMDAVARSTAGSGRSRSCCTFCGVLRRRALEEGARRVGATHIVTGHNADDMAETVLMNFLRGDAGRLARGGGLGS

• Full Name: ATP binding domain 3
• Calculated Molecular Weight: 36 kDa
• Observed Molecular Weight: 30-36 kDa
• GenBank Accession Number: NM_145232
• Gene Symbol: ATPBD3
• Gene ID (NCBI): 90353
• RRID: AB_3670027
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q7Z7A3
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

ATPBD3, also known as CTU1, NCS6, is a subunit of a highly conserved protein complex involved in the thiolation of wobble U34(PMID: 18391219). ATPBD3 directly binds tRNAs and probably acts by catalyzing the adenylation of tRNAs, an intermediate required for 2-thiolation.