AVEN Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• AVEN Polyclonal antibody, PBS Only (25846-1-PBS)

• 

  WB analysis of MCF-7 using 25846-1-AP (same clone as 25846-1-PBS)

  MCF-7 cells were subjected to SDS PAGE followed by western blot with 25846-1-AP (AVEN Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25846-1-PBS in a different storage buffer formulation.

• 

  WB analysis of K-562 using 25846-1-AP (same clone as 25846-1-PBS)

  K-562 cells were subjected to SDS PAGE followed by western blot with 25846-1-AP (AVEN Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25846-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon using 25846-1-AP (same clone as 25846-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 25846-1-AP (AVEN antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 25846-1-PBS in a different storage buffer formulation.

AVEN Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 25846-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

Cell death regulator Aven, PDCD12

---

Product Information

25846-1-PBS targets AVEN in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag23020

  Product name: Recombinant human AVEN protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-362 aa of BC010488

  Sequence: MQAERGARGGRGRRPGRGRPGGDRHSERPGAAAAVARGGGGGGGGDGGGRRGRGRGRGFRGARGGRGGGGAPRGSRREPGGWGAGASAPVEDDSDAETYGEENDEQGNYSKRKIVSNWDRYQDIEKEVNNESGESQRGTDFSVLLSSAGDSFSQFRFAEEKEWDSEASCPKQNSAFYVDSELLVRALQELPLCLRLNVAAELVQGTVPLEVPQVKPKRTDDGKGLGMQLKGPLGPGGRGPIFELKSVAAGCPVLLGKDNPSPGPSRDSQKPTSPLQSAGDHLEEELDLLLNLDAPIKEGDNILPDQTSQDLKSKEDGEVVQEEEVCAKPSVTEEKNMEPEQPSTSKNVTEEELEDWLDSMIS

• Full Name: apoptosis, caspase activation inhibitor
• Calculated Molecular Weight: 39 kDa
• Observed Molecular Weight: 50 kDa
• GenBank Accession Number: BC010488
• Gene Symbol: AVEN
• Gene ID (NCBI): 57099
• RRID: AB_2880266
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NQS1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

AVEN (Apoptosis caspase activation inhibitor) is known to play a role in male and female germ cell development. AVEN protein has also been shown to inhibit the mitochondrial apoptosis pathway by binding to and inhibiting the self-association of proapoptotic APAF-1, as well as binding to and enhancing antiapoptotic BCL-xL activity. AVEN has also recently been shown to function as an activator of the cell cycle-regulating ATM kinase in the DNA damage response pathway. Molecular weight of this protein detected by WB is 50 kDa (PMID: 22751129).