AVPR2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• AVPR2 Polyclonal antibody, PBS Only (27691-1-PBS)

• 

  WB analysis using 27691-1-AP (same clone as 27691-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 27691-1-AP (AVPR2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 27691-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 27691-1-AP (same clone as 27691-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 27691-1-AP (AVPR2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 27691-1-PBS in a different storage buffer formulation.

AVPR2 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 27691-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

ADHR, Antidiuretic hormone receptor, AVPR V2, DI1, DIR

---

Product Information

27691-1-PBS targets AVPR2 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag24835

  Product name: Recombinant human AVPR2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-83 aa of BC112181

  Sequence: MLMASTTSAVPGHPSLPSLPSNSSQERPLDTRDPLLARAELALLSIVFVAVALSNGLVLAALARRGRRGHWAPIHVFIGHLCL

• Full Name: arginine vasopressin receptor 2
• Calculated Molecular Weight: 371 aa, 40 kDa
• Observed Molecular Weight: 49 kDa
• GenBank Accession Number: BC112181
• Gene Symbol: AVPR2
• Gene ID (NCBI): 554
• RRID: AB_3742249
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P30518
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

AVPR2 is a Gs-coupled vasopressin receptor essential for renal water reabsorption, acting through cAMP-PKA-dependent trafficking of aquaporin-2. Localized to principal cells of the collecting duct, AVPR2 integrates hormonal cues to maintain osmotic and fluid homeostasis. Mutations lead to X-linked nephrogenic diabetes insipidus, while rare activating variants cause SIADH. Because of its central role in renal physiology and clear clinical associations, AVPR2 is a key target in water-balance disorders and pharmacologic modulation of diuresis.