AWAT1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• AWAT1 Polyclonal antibody, PBS Only (24704-1-PBS)

• 

  WB analysis using 24704-1-AP (same clone as 24704-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 24704-1-AP (AWAT1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 24704-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse liver using 24704-1-AP (same clone as 24704-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 24704-1-AP (AWAT1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 24704-1-PBS in a different storage buffer formulation.

AWAT1 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 24704-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, Indirect ELISA

Synonyms

DGA2, DGAT2L3

---

Product Information

24704-1-PBS targets AWAT1 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag20183

  Product name: Recombinant human AWAT1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 134-195 aa of BC153034

  Sequence: LATLSWFFKIPFVREYLMAKGVCSVSQPAINYLLSHGTGNLVGIVVGGVGEALQSVPNTTTL

• Full Name: acyl-CoA wax alcohol acyltransferase 1
• Calculated Molecular Weight: 328 aa, 38 kDa
• Observed Molecular Weight: 45 kDa
• GenBank Accession Number: BC153034
• Gene Symbol: AWAT1
• Gene ID (NCBI): 158833
• RRID: AB_3742123
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q58HT5
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

AWAT1 is an ER-localized acyltransferase specialized for wax ester biosynthesis in sebaceous and meibomian glands. By esterifying long-chain fatty acyl-CoAs with fatty alcohols, AWAT1 generates crucial lipids that maintain skin barrier function, sebaceous secretion, and tear film stability. Dysregulation of AWAT1 contributes to meibomian gland dysfunction, dry eye disease, and sebaceous lipid imbalance, positioning AWAT1 as a key enzymatic regulator of surface lipid homeostasis.