Tested Applications
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
CL488-83631-2 targets AXIN2 in IF/ICC applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag14574 Product name: Recombinant human AXIN2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 30-83 aa of BC006295 Sequence: EGETPPCQPGVGKGQVTKPMPVSSNTRRNEDGLGEPEGRASPDSPLTRWTKSLH Predict reactive species |
| Full Name | axin 2 |
| Calculated Molecular Weight | 843 aa, 94 kDa |
| Observed Molecular Weight | 94-100 kDa |
| GenBank Accession Number | BC006295 |
| Gene Symbol | AXIN2 |
| Gene ID (NCBI) | 8313 |
| Conjugate | CoraLite® Plus 488 Fluorescent Dye |
| Excitation/Emission Maxima Wavelengths | 493 nm / 522 nm |
| Excitation Laser | Blue laser (488 nm) |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q9Y2T1 |
| Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. |
| Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
Axis inhibition protein2 (AXIN2), also known as Coductin or Axil, is a multidomain scaffold protein that negatively regulate Wnt signaling. AXIN2 can directly interact with beta-catenin and GSK3B. AXIN2 has a number of phosphorylation sites, and also can undergo poly(ADP-ribosy)lation by tankyrase TNKS and TNKS2. Poly(ADP-ribosy)lated AXIN2 then get unbiquitinated by RNF146 and leads to its degradation and subsequent activation of Wnt signaling. AXIN2 is localized in the cytoplasm and its mutation is involved in colorectal cancer.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CL Plus 488 AXIN2 antibody CL488-83631-2 | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
