ADSL Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• ADSL Polyclonal antibody, PBS Only (15264-1-PBS)

• 

  WB analysis using 15264-1-AP (same clone as 15264-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 15264-1-AP (Adenylosuccinate lyase antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15264-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 15264-1-AP (same clone as 15264-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 15264-1-AP (Adenylosuccinate lyase antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15264-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HepG2 using 15264-1-AP (same clone as 15264-1-PBS)

  HepG2 cells were subjected to SDS PAGE followed by western blot with 15264-1-AP (Adenylosuccinate lyase antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15264-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 15264-1-AP (same clone as 15264-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer using 15264-1-AP (Adenylosuccinate lyase antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 15264-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 15264-1-AP (same clone as 15264-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer using 15264-1-AP (Adenylosuccinate lyase antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 15264-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 15264-1-AP (same clone as 15264-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using Adenylosuccinate lyase antibody (15264-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 15264-1-PBS in a different storage buffer formulation.

• 

  FC experiment of HeLa using 15264-1-AP (same clone as 15264-1-PBS)

  1x10^6 HeLa cells were intracellularly stained with 0.25 ug Adenylosuccinate lyase Polyclonal antibody (15264-1-AP) and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.25 ug Rabbit IgG control Rabbit PolyAb (30000-0-AP) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 15264-1-PBS in a different storage buffer formulation.

ADSL Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), Indirect ELISA

Cat No. 15264-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, FC (Intra), Indirect ELISA

Synonyms

EC:4.3.2.2, ASL, ASASE, AMPS

---

Product Information

15264-1-PBS targets ADSL in WB, IHC, IF/ICC, FC (Intra), Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7332

  Product name: Recombinant human ADSL protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-354 aa of BC000253

  Sequence: MAAGGDHGSPDSYRSPLASRYASPEMCFVFSDRYKFRTWRQLWLWLAEAEQTLGLPITDEQIQEMKSNLENIDFKMAAEEEKRLRHDVMAHVHTFGHCCPKAAGIIHLGATSCYVGDNTDLIILRNALDLLLPKLARVISRLADFAKERASLPTLGFTHFQPAQLTTVGKRCCLWIQDLCMDLQNLKRVRDDLRFRGVKGTTGTQASFLQLFEGDDHKVEQLDKMVTEKAGFKRAFIITGQTYTRKVDIEVLSVLASLGASVHKICTDIRLLANLKEMEEPFEKQQIGSSAMPYKRNPMRSERCCSLARHLMTLVMDPLQTASVQWFERTLDDSANRRICLAEAFLTADTILNT

• Full Name: adenylosuccinate lyase
• Calculated Molecular Weight: 55 kDa
• Observed Molecular Weight: 55 kDa
• GenBank Accession Number: BC000253
• Gene Symbol: ADSL
• Gene ID (NCBI): 158
• RRID: AB_2225668
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P30566
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

ADSL(adenylosuccinate lyase) is also named as AMPS, ASase, ASL and belongs to the lyase 1 family. It is an enzyme involved in 2 pathways of purine nucleotide metabolism and catalyzes cleavage of succinyl groups to yield fumarate(PMID:18524658). Defects in ADSL are the cause of adenylosuccinase deficiency (ADSL deficiency). In humans, mutations in ADSL lead to an inborn error of metabolism originally characterized by developmental delay, often with autistic features(PMID:20884265)..The ADSL enzymatic activity is reduced in lymphocytes and red blood cells of the patient with severe psychomotor retardation(PMID:9545543). It has 2 isoforms produced by alternative splicing.