Use Able AI chat for product recommendations

CoraLite®488-conjugated Adiponectin Monoclonal antibody

Adiponectin Monoclonal Antibody for IF/ICC

Cat No. CL488-66239
Clone No.5D8A7

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse

Applications

IF/ICC

ACDC, ACRP30, adiponectin, ADIPOQ, ADIPQTL1, ADPN, APM 1, APM1, GBP28, Gelatin binding protein

Formulation:  PBS, Proclin300, BSA, Glycerol
PBS, Proclin300, BSA, Glycerol
Conjugate:  CoraLite®488
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected in3T3-L1 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-66239 targets Adiponectin in IF/ICC applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag17383

Product name: Recombinant human ADIPOQ protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-244 aa of BC096308

Sequence: MLLLGAVLLLLALPGHDQETTTQGPGVLLPLPKGACTGWMAGIPGHPGHNGAPGRDGRDGTPGEKGEKGDPGLIGPKGDIGETGVPGAEGPRGFPGIQGRKGEPGEGAYVYRSAFSVGLETYVTIPNMPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFAYHITVYMKDVKVSLFKKDKAMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFLLYHDTN

Predict reactive species
Full Name adiponectin, C1Q and collagen domain containing
Calculated Molecular Weight 244 aa, 26 kDa
Observed Molecular Weight 29 kDa
GenBank Accession NumberBC096308
Gene Symbol Adiponectin
Gene ID (NCBI) 9370
RRIDAB_2923753
Conjugate CoraLite®488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths491 nm / 516 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ15848
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Adiponectin (AdipoQ), an adipocyte-derived hormone, is one of the most abundant adipokines in the blood circulation. Adiponectin modulates a number of metabolic processes, including improving insulin sensitivity and anti-inflammatory activity. The role of AdipoQ in reproduction is not yet fully understood, but the expression of AdipoQ in reproductive tissues has been observed in various animals and humans, including chicken testis, bovine ovary, and human placenta. Adiponectin exerts its effects by activating a range of different signaling molecules via binding to two transmembrane AdipoQ receptors, AdipoR1 and AdipoR2. AdipoR1 is expressed primarily in the skeletal muscle, whereas AdipoR2 is predominantly expressed in the liver. AdipoQ May play a role in cell growth, angiogenesis and tissue remodeling by binding and sequestering various growth factors.

Protocols

Product Specific Protocols
IF protocol for CL488 Adiponectin antibody CL488-66239Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...