CoraLite® Plus 488-conjugated Adiponectin Recombinant monoclonal antibody

• 

  IF Staining of NIH/3T3 using CL488-83961-3

  Immunofluorescent analysis of (-20°C Ethanol) fixed NIH/3T3 cells using CoraLite® Plus 488 Adiponectin antibody (CL488-83961-3, Clone: 241082E1 ) at dilution of 1:200.

Adiponectin Uni-rAb^® Recombinant Antibody for IF/ICC

Cat No. CL488-83961-3

Clone No.241082E1

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IF/ICC

Synonyms

ADIPOQ, 30 kDa adipocyte complement-related protein, Adipocyte complement-related 30 kDa protein, Adipocyte, C1q and collagen domain-containing protein, ADIPQTL1

---

Tested Applications

• Positive IF/ICC detected in: NIH/3T3 cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-83961-3 targets Adiponectin in IF/ICC applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag16304

  Product name: Recombinant human ADIPOQ protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-244 aa of BC096308

  Sequence: MLLLGAVLLLLALPGHDQETTTQGPGVLLPLPKGACTGWMAGIPGHPGHNGAPGRDGRDGTPGEKGEKGDPGLIGPKGDIGETGVPGAEGPRGFPGIQGRKGEPGEGAYVYRSAFSVGLETYVTIPNMPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFAYHITVYMKDVKVSLFKKDKAMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFLLYHDTN

• Full Name: adiponectin, C1Q and collagen domain containing
• Calculated Molecular Weight: 244 aa, 26 kDa
• GenBank Accession Number: BC096308
• Gene Symbol: Adiponectin
• Gene ID (NCBI): 9370
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q15848
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

not yet fully understood, but the expression of AdipoQ in reproductive tissues has been observed in various animals and humans, including chicken testis, bovine ovary, and human placenta. Adiponectin exerts its effects by activating a range of different signaling molecules via binding to two transmembrane AdipoQ receptors, AdipoR1 and AdipoR2. AdipoR1 is expressed primarily in the skeletal muscle, whereas AdipoR2 is predominantly expressed in the liver. AdipoQ May play a role in cell growth, angiogenesis and tissue remodeling by binding and sequestering various growth factors.