Adiponectin receptor Recombinant monoclonal antibody, PBS Only

Adiponectin receptor Uni-rAb® Recombinant Antibody for WB, IHC, IF-P, IP, Indirect ELISA
Cat No. 85121-4-PBS
Clone No.242777F3

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, IP, Indirect ELISA

ADIPOR2, 242777F3, ACDCR2, adiponectin receptor 2, Adiponectin receptor protein 2

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

85121-4-PBS targets Adiponectin receptor in WB, IHC, IF-P, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag5744

Product name: Recombinant human ADIPOR2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-147 aa of BC051858

Sequence: MNEPTENRLGCSRTPEPDIRLRKGHQLDGTRRGDNDSHQGDLEPILEASVLSSHHKKSSEEHEYSDEAPQEDEGFMGMSPLLQAHHAMEKMEEFVCKVWEGRWRVIPHDVLPDWLKDNDFLLHGHRPPMPSFRACFKSIFRIHTETG

Predict reactive species
Full Name adiponectin receptor 2
Calculated Molecular Weight 44 kDa
Observed Molecular Weight45 kDa
GenBank Accession NumberBC051858
Gene Symbol Adiponectin receptor
Gene ID (NCBI) 79602
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ86V24
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Adiponectin is a hormone secreted by adipocytes that acts as an antidiabetic and anti-atherogenic adipokine. Two receptors for adiponectin (ADIPOR1 and ADIPOR2) have been identified. They mediate increased AMPK, MAPK, and PPARA ligand activity in response to adiponectin. AdipoR1 is abundantly expressed in skeletal muscle, whereas AdipoR2 is predominantly expressed in the liver (PMID: 12802337). The human ADIPOR2 gene maps to chromosome 12p13.31, and encodes a 386-amino acid protein with a molecular weight of 44 kDa. AdipoR2 may also exist as stable ~ 60 kDa dimers (PMID: 18842004). This antibody raised against 1-147aa of human AdipoR2 may cross-react with AdipoR1.

Loading...
||
New chat Able
正在加载,请稍候...