Adiponectin receptor Recombinant monoclonal antibody

Adiponectin receptor Uni-rAb® Recombinant Antibody for WB, IHC, IF-P, IP, ELISA
Cat No. 85121-4-RR
Clone No.242777F3

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, IP, ELISA

ADIPOR2, 242777F3, ACDCR2, adiponectin receptor 2, Adiponectin receptor protein 2

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, A549 cells, L02 cells, rat uterus tissue, human placenta tissue
Positive IP detected inmouse liver tissue
Positive IHC detected inrat liver tissue, mouse liver tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inmouse liver tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:400-1:1600
Immunofluorescence (IF)-PIF-P : 1:300-1:1200
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

85121-4-RR targets Adiponectin receptor in WB, IHC, IF-P, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag5744

Product name: Recombinant human ADIPOR2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-147 aa of BC051858

Sequence: MNEPTENRLGCSRTPEPDIRLRKGHQLDGTRRGDNDSHQGDLEPILEASVLSSHHKKSSEEHEYSDEAPQEDEGFMGMSPLLQAHHAMEKMEEFVCKVWEGRWRVIPHDVLPDWLKDNDFLLHGHRPPMPSFRACFKSIFRIHTETG

Predict reactive species
Full Name adiponectin receptor 2
Calculated Molecular Weight 44 kDa
Observed Molecular Weight45 kDa
GenBank Accession NumberBC051858
Gene Symbol Adiponectin receptor
Gene ID (NCBI) 79602
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ86V24
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Adiponectin is a hormone secreted by adipocytes that acts as an antidiabetic and anti-atherogenic adipokine. Two receptors for adiponectin (ADIPOR1 and ADIPOR2) have been identified. They mediate increased AMPK, MAPK, and PPARA ligand activity in response to adiponectin. AdipoR1 is abundantly expressed in skeletal muscle, whereas AdipoR2 is predominantly expressed in the liver (PMID: 12802337). The human ADIPOR2 gene maps to chromosome 12p13.31, and encodes a 386-amino acid protein with a molecular weight of 44 kDa. AdipoR2 may also exist as stable ~ 60 kDa dimers (PMID: 18842004). This antibody raised against 1-147aa of human AdipoR2 may cross-react with AdipoR1.

Protocols

Product Specific Protocols
IF protocol for Adiponectin receptor antibody 85121-4-RRDownload protocol
IHC protocol for Adiponectin receptor antibody 85121-4-RRDownload protocol
IP protocol for Adiponectin receptor antibody 85121-4-RRDownload protocol
WB protocol for Adiponectin receptor antibody 85121-4-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...