CoraLite® Plus 488-conjugated Adiponectin receptor Recombinant monoclonal antibody

Adiponectin receptor Uni-rAb® Recombinant Antibody for IF-P
Cat No. CL488-85121-4
Clone No.242777F3

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF-P

ADIPOR2, 242777F3, ACDCR2, adiponectin receptor 2, Adiponectin receptor protein 2

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF-P detected inmouse liver tissue

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)-PIF-P : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-85121-4 targets Adiponectin receptor in IF-P applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag5744

Product name: Recombinant human ADIPOR2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-147 aa of BC051858

Sequence: MNEPTENRLGCSRTPEPDIRLRKGHQLDGTRRGDNDSHQGDLEPILEASVLSSHHKKSSEEHEYSDEAPQEDEGFMGMSPLLQAHHAMEKMEEFVCKVWEGRWRVIPHDVLPDWLKDNDFLLHGHRPPMPSFRACFKSIFRIHTETG

Predict reactive species
Full Name adiponectin receptor 2
Calculated Molecular Weight 44 kDa
GenBank Accession NumberBC051858
Gene Symbol Adiponectin receptor
Gene ID (NCBI) 79602
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ86V24
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Adiponectin is a hormone secreted by adipocytes that acts as an antidiabetic and anti-atherogenic adipokine. Two receptors for adiponectin (ADIPOR1 and ADIPOR2) have been identified. They mediate increased AMPK, MAPK, and PPARA ligand activity in response to adiponectin. AdipoR1 is abundantly expressed in skeletal muscle, whereas AdipoR2 is predominantly expressed in the liver. The human ADIPOR2 gene maps to chromosome 12p13.31, and encodes a 386-amino acid protein with a molecular weight of 44 kDa. AdipoR2 may also exist as stable ~ 60 kDa dimers (PMID: 18842004). This antibody raised against 1-147aa of human AdipoR2 may cross-react with AdipoR1.

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 Adiponectin receptor antibody CL488-85121-4Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...