YTHDF1 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 80876-2-RR (same clone as 80876-2-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 80876-2-RR (Ag11509 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 80876-2-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 80876-2-RR (same clone as 80876-2-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 80876-2-RR (YTHDF1 antibody) at dilution of 1:1500 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 80876-2-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse brain using 80876-2-RR (same clone as 80876-2-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse brain tissue using YTHDF1 antibody (80876-2-RR, Clone: 241445B10 ) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 80876-2-PBS in a different storage buffer formulation.

• 

  IF Staining of U2OS using 80876-2-RR (same clone as 80876-2-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed U2OS cells using YTHDF1 antibody (80876-2-RR, Clone: 241445B10 ) at dilution of 1:500 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 80876-2-PBS in a different storage buffer formulation.

• 

  FC experiment of HEK-293 using 80876-2-RR (same clone as 80876-2-PBS)

  1x10^6 HEK-293 cells were intracellularly stained with 0.25 ug YTHDF1 Recombinant antibody (80876-2-RR, Clone:241445B10) and APC-Conjugated Goat Anti-Rabbit IgG(H+L)(red), or 0.25 ug Isotype Control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer (PF00011-C). This data was developed using the same antibody clone with 80876-2-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 80876-2-RR

  Biolayer interferometry (BLl) kinetic assays of 80876-2-RR against Human YTHDF1 were performed. The affinity constant is 7.23 nM.

YTHDF1 Uni-rAb^® Recombinant Antibody for WB, IHC, IF/ICC, IF-P, FC (Intra), Indirect ELISA

Cat No. 80876-2-PBS

Clone No.241445B10

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IF-P, FC (Intra), Indirect ELISA

Synonyms

241445B10, C20orf21, DACA-1, DF1, YTH domain-containing family protein 1

---

Product Information

80876-2-PBS targets YTHDF1 in WB, IHC, IF/ICC, IF-P, FC (Intra), Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag11509

  Product name: Recombinant human YTHDF1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 210-559 aa of BC050284

  Sequence: VALTGVLSGNGGTNVNMPVSKPTSWAAIASKPAKPQPKMKTKSGPVMGGGLPPPPIKHNMDIGTWDNKGPVPKAPVPQQAPSPQAAPQPQQVAQPLPAQPPALAQPQYQSPQQPPQTRWVAPRNRNAAFGQSGGAGSDSNSPGNVQPNSAPSVESHPVLEKLKAAHSYNPKEFEWNLKSGRVFIIKSYSEDDIHRSIKYSIWCSTEHGNKRLDSAFRCMSSKGPVYLLFSVNGSGHFCGVAEMKSPVDYGTSAGVWSQDKWKGKFDVQWIFVKDVPNNQLRHIRLENNDNKPVTNSRDTQEVPLEKAKQVLKIISSYKHTTSIFDDFAHYEKRQEEEEVVRKERQSRNKQ

• Full Name: YTH domain family, member 1
• Calculated Molecular Weight: 559 aa, 61 kDa
• Observed Molecular Weight: 60-65 kDa
• GenBank Accession Number: BC050284
• Gene Symbol: YTHDF1
• Gene ID (NCBI): 54915
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9BYJ9
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.