• Featured Product
  • KD/KO Validated

Alpha-1-Antitrypsin Recombinant monoclonal antibody, PBS Only

Alpha-1-Antitrypsin Uni-rAb® Recombinant Antibody for WB, IHC, FC (Intra), Indirect ELISA
Cat No. 82918-1-PBS
Clone No.230109A8

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, FC (Intra), Indirect ELISA

a1-antitrypsin, Serpin A1, SERPINA1, 230109A8, A1A

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

82918-1-PBS targets Alpha-1-Antitrypsin in WB, IHC, FC (Intra), Indirect ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag9369

Product name: Recombinant human Alpha-1-Antitrypsin protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 28-418 aa of BC015642

Sequence: QGDAAQKTDTSHHDQDHPTFNKITPNLAEFAFSLYRQLAHQSNSTNIFFSPVSIATAFAMLSLGTKADTHDEILEGLNFNLTEIPEAQIHEGFQELLRTLNQPDSQLQLTTGNGLFLSEGLKLVDKFLEDVKKLYHSEAFTVNFGDTEEAKKQINDYVEKGTQGKIVDLVKELDRDTVFALVNYIFFKGKWERPFEVKDTEEEDFHVDQATTVKVPMMKRLGMFNIQHCKKLSSWVLLMKYLGNATAIFFLPDEGKLQHLENELTHDIITKFLENEDRRSASLHLPKLSITGTYDLKSVLGQLGITKVFSNGADLSGVTEEAPLKLSKAVHKAVLTIDEKGTEAAGAMFLEAIPMSIPPEVKFNKPFVFLMIEQNTKSPLFMGKVVNPTQK

Predict reactive species
Full Name serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1
Calculated Molecular Weight 418 aa, 47 kDa
Observed Molecular Weight 47 kDa
GenBank Accession NumberBC015642
Gene Symbol Alpha 1-Antitrypsin
Gene ID (NCBI) 5265
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP01009
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

SERPINA1 is the gene for a protein called alpha-1-antitrypsin (AAT), which is a serine protease inhibitor whose targets include elastase, plasmin, thrombin, trypsin, chymotrypsin, and plasminogen activator. AAT is a glycoprotein synthesized primarily by hepatocytes, with smaller amountssynthesized by intestinal epithelial cells, neutrophils, pulmonary alveolar cells and macrophages. AAT is the most abundant, endogenous serine protease inhibitor in blood circulation and it has been implicated in regulating vital fluid phase biological events such as blood coagulation, fibrinolysis, complement activation, apoptosis, reproduction, tumor progression and inflammatory response. The primary function of AAT is thought to be the inactivation of neutrophil elastase and other endogenous serine proteases. Defects in SERPINA1 can cause emphysema or liver disease.

Loading...
||
New chat

Able

正在加载,请稍候...