• Featured Product
  • KD/KO Validated

Alpha-1-Antitrypsin Recombinant monoclonal antibody

Alpha-1-Antitrypsin Uni-rAb® Recombinant Antibody for WB, IHC, FC (Intra), ELISA
Cat No. 82918-1-RR
Clone No.230109A8

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, FC (Intra), ELISA

a1-antitrypsin, Serpin A1, SERPINA1, AAT, A1AT

Formulation:  PBS and Azide
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inhuman liver tissue, HepG2 cells, human heart tissue, human saliva, human placenta tissue, human urine
Positive IHC detected inhuman colon tissue, human stomach tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive FC (Intra) detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:3200-1:12800
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

82918-1-RR targets Alpha-1-Antitrypsin in WB, IHC, FC (Intra), ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag9369

Product name: Recombinant human Alpha-1-Antitrypsin protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 28-418 aa of BC015642

Sequence: QGDAAQKTDTSHHDQDHPTFNKITPNLAEFAFSLYRQLAHQSNSTNIFFSPVSIATAFAMLSLGTKADTHDEILEGLNFNLTEIPEAQIHEGFQELLRTLNQPDSQLQLTTGNGLFLSEGLKLVDKFLEDVKKLYHSEAFTVNFGDTEEAKKQINDYVEKGTQGKIVDLVKELDRDTVFALVNYIFFKGKWERPFEVKDTEEEDFHVDQATTVKVPMMKRLGMFNIQHCKKLSSWVLLMKYLGNATAIFFLPDEGKLQHLENELTHDIITKFLENEDRRSASLHLPKLSITGTYDLKSVLGQLGITKVFSNGADLSGVTEEAPLKLSKAVHKAVLTIDEKGTEAAGAMFLEAIPMSIPPEVKFNKPFVFLMIEQNTKSPLFMGKVVNPTQK

Predict reactive species
Full Name serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1
Calculated Molecular Weight 418 aa, 47 kDa
Observed Molecular Weight 47 kDa
GenBank Accession NumberBC015642
Gene Symbol Alpha 1-Antitrypsin
Gene ID (NCBI) 5265
RRIDAB_3668844
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP01009
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SERPINA1 is the gene for a protein called alpha-1-antitrypsin (AAT), which is a serine protease inhibitor whose targets include elastase, plasmin, thrombin, trypsin, chymotrypsin, and plasminogen activator. AAT is a glycoprotein synthesized primarily by hepatocytes, with smaller amountssynthesized by intestinal epithelial cells, neutrophils, pulmonary alveolar cells and macrophages. AAT is the most abundant, endogenous serine protease inhibitor in blood circulation and it has been implicated in regulating vital fluid phase biological events such as blood coagulation, fibrinolysis, complement activation, apoptosis, reproduction, tumor progression and inflammatory response. The primary function of AAT is thought to be the inactivation of neutrophil elastase and other endogenous serine proteases. Defects in SERPINA1 can cause emphysema or liver disease.

Protocols

Product Specific Protocols
WB protocol for Alpha-1-Antitrypsin antibody 82918-1-RRDownload protocol
IHC protocol for Alpha-1-Antitrypsin antibody 82918-1-RRDownload protocol
FC protocol for Alpha-1-Antitrypsin antibody 82918-1-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...