Alpha Sarcoglycan Monoclonal antibody, PBS Only

• 

  WB analysis using 67078-1-Ig (same clone as 67078-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67078-1-Ig (Alpha sarcoglycan antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67078-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human skeletal muscle using 67078-1-Ig (same clone as 67078-1-PBS)

  human skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 67078-1-Ig (Alpha sarcoglycan antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67078-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 67078-1-Ig (same clone as 67078-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67078-1-Ig (Alpha sarcoglycan antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67078-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human heart using 67078-1-Ig (same clone as 67078-1-PBS)

  human heart tissue were subjected to SDS PAGE followed by western blot with 67078-1-Ig (Alpha sarcoglycan antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67078-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse skeletal muscle using 67078-1-Ig (same clone as 67078-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse skeletal muscle tissue slide using 67078-1-Ig (Alpha Sarcoglycan antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67078-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse skeletal muscle using 67078-1-Ig (same clone as 67078-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse skeletal muscle tissue slide using 67078-1-Ig (Alpha Sarcoglycan antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67078-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse skeletal muscle using 67078-1-Ig (same clone as 67078-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse skeletal muscle tissue slide using 67078-1-Ig (Alpha Sarcoglycan antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67078-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 67078-1-Ig (same clone as 67078-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 67078-1-Ig (Alpha Sarcoglycan antibody) at dilution of 1:4000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67078-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 67078-1-Ig (same clone as 67078-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 67078-1-Ig (Alpha Sarcoglycan antibody) at dilution of 1:4000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67078-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse heart using 67078-1-Ig (same clone as 67078-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 67078-1-Ig (Alpha Sarcoglycan antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67078-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse heart using 67078-1-Ig (same clone as 67078-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 67078-1-Ig (Alpha Sarcoglycan antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67078-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse tongue using 67078-1-Ig (same clone as 67078-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse tongue tissue slide using 67078-1-Ig (Alpha Sarcoglycan antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67078-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse tongue using 67078-1-Ig (same clone as 67078-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse tongue tissue slide using 67078-1-Ig (Alpha Sarcoglycan antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67078-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat heart using 67078-1-Ig (same clone as 67078-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat heart tissue slide using 67078-1-Ig (Alpha Sarcoglycan antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67078-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat heart using 67078-1-Ig (same clone as 67078-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat heart tissue slide using 67078-1-Ig (Alpha Sarcoglycan antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67078-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat skeletal muscle using 67078-1-Ig (same clone as 67078-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat skeletal muscle tissue slide using 67078-1-Ig (Alpha Sarcoglycan antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67078-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat skeletal muscle using 67078-1-Ig (same clone as 67078-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat skeletal muscle tissue slide using 67078-1-Ig (Alpha Sarcoglycan antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67078-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse heart using 67078-1-Ig (same clone as 67078-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed mouse heart tissue using Alpha Sarcoglycan antibody (67078-1-Ig, Clone: 2B10H7 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 67078-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse heart using 67078-1-Ig (same clone as 67078-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed mouse heart tissue using Alpha Sarcoglycan antibody (67078-1-Ig, Clone: 2B10H7 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 67078-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse skeletal muscle using 67078-1-Ig (same clone as 67078-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse skeletal muscle tissue using Alpha Sarcoglycan antibody (67078-1-Ig, Clone: 2B10H7 ) at dilution of 1:800 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L) (SA00013-1). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67078-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse skeletal muscle using 67078-1-Ig (same clone as 67078-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse skeletal muscle tissue using Alpha Sarcoglycan antibody (67078-1-Ig, Clone: 2B10H7 ) at dilution of 1:800 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L) (SA00013-1). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67078-1-PBS in a different storage buffer formulation.

Alpha Sarcoglycan Monoclonal Antibody for WB, IHC, IF-P, Indirect ELISA

Cat No. 67078-1-PBS

Clone No.2B10H7

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse, rat, pig

Applications

WB, IHC, IF-P, Indirect ELISA

Synonyms

SGCA, SCARMD1, LGMD2D, Alpha-SG, Alpha-sarcoglycan

---

Product Information

67078-1-PBS targets Alpha Sarcoglycan in WB, IHC, IF-P, Indirect ELISA applications and shows reactivity with human, mouse, rat, pig samples.

• Tested Reactivity: human, mouse, rat, pig
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28800

  Product name: Recombinant human SGCA protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 25-289 aa of BC025702

  Sequence: QTTLHPLVGRVFVHTLDHETFLSLPEHVAVPPAVHITYHAHLQGHPDLPRWLRYTQRSPHHPGFLYGSATPEDRGLQVIEVTAYNRDSFDTTRQRLVLEIGDPEGPLLPYQAEFLVRSHDAEEVLPSTPASRFLSALGGLWEPGELQLLNVTSALDRGGRVPLPIEGRKEGVYIKVGSASPFSTCLKMVASPDSHARCAQGQPPLLSCYDTLAPHFRVDWCNVTLVDKSVPEPADEVPTPGDGILEHDPFFCPPTEAPDRDFLVD

• Full Name: sarcoglycan, alpha (50kDa dystrophin-associated glycoprotein)
• Calculated Molecular Weight: 387 aa, 43 kDa
• Observed Molecular Weight: 50 kDa
• GenBank Accession Number: BC025702
• Gene Symbol: alpha Sarcoglycan
• Gene ID (NCBI): 6442
• RRID: AB_2882386
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q16586
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Alpha-sarcoglycan is a member of the sarcoglycan-sarcospan complex (SG-SSPN), which is constituted by α/ɛ-, β-, γ-, and δ-SGs as well as SSPN. Alpha-sarcoglycan gene expression is exclusive of striated muscle and is finely regulated during myogenic differentiation, where the amount of alpha-sarcoglycan transcript is selectively increased after differentiation to myotubes (MTs). Alpha sarcoglycan's disruption causes limb-girdle muscular dystrophy.