Alpha Sarcoglycan Monoclonal antibody

Alpha Sarcoglycan Monoclonal Antibody for WB, IHC, IF-P, ELISA
Cat No. 67078-1-Ig
Clone No.2B10H7

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse, rat, pig

Applications

WB, IHC, IF-P, ELISA

SGCA, SCARMD1, LGMD2D, Alpha-SG, Alpha-sarcoglycan

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inhuman skeletal muscle tissue, human heart tissue, pig heart tissue, rat skeletal muscle tissue, pig skeletal muscle tissue, rat heart tissue, mouse skeletal muscle tissue
Positive IHC detected inmouse skeletal muscle tissue, human liver tissue, mouse heart tissue, mouse tongue tissue, rat heart tissue, rat skeletal muscle tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inmouse heart tissue, mouse skeletal muscle tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:10000
Immunohistochemistry (IHC)IHC : 1:500-1:2000
Immunofluorescence (IF)-PIF-P : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

67078-1-Ig targets Alpha Sarcoglycan in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat, pig samples.

Tested Reactivity human, mouse, rat, pig
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag28800

Product name: Recombinant human SGCA protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 25-289 aa of BC025702

Sequence: QTTLHPLVGRVFVHTLDHETFLSLPEHVAVPPAVHITYHAHLQGHPDLPRWLRYTQRSPHHPGFLYGSATPEDRGLQVIEVTAYNRDSFDTTRQRLVLEIGDPEGPLLPYQAEFLVRSHDAEEVLPSTPASRFLSALGGLWEPGELQLLNVTSALDRGGRVPLPIEGRKEGVYIKVGSASPFSTCLKMVASPDSHARCAQGQPPLLSCYDTLAPHFRVDWCNVTLVDKSVPEPADEVPTPGDGILEHDPFFCPPTEAPDRDFLVD

Predict reactive species
Full Name sarcoglycan, alpha (50kDa dystrophin-associated glycoprotein)
Calculated Molecular Weight 387 aa, 43 kDa
Observed Molecular Weight 50 kDa
GenBank Accession NumberBC025702
Gene Symbol alpha Sarcoglycan
Gene ID (NCBI) 6442
RRIDAB_2882386
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ16586
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Alpha-sarcoglycan is a member of the sarcoglycan-sarcospan complex (SG-SSPN), which is constituted by α/ɛ-, β-, γ-, and δ-SGs as well as SSPN. Alpha-sarcoglycan gene expression is exclusive of striated muscle and is finely regulated during myogenic differentiation, where the amount of alpha-sarcoglycan transcript is selectively increased after differentiation to myotubes (MTs). Alpha sarcoglycan's disruption causes limb-girdle muscular dystrophy.

Protocols

Product Specific Protocols
IF protocol for Alpha Sarcoglycan antibody 67078-1-IgDownload protocol
IHC protocol for Alpha Sarcoglycan antibody 67078-1-IgDownload protocol
WB protocol for Alpha Sarcoglycan antibody 67078-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...