Amylase Alpha Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Amylase Alpha Polyclonal antibody, PBS Only (12540-1-PBS)

• 

  WB analysis of mouse pancreas using 12540-1-AP (same clone as 12540-1-PBS)

  mouse pancreas tissue were subjected to SDS PAGE followed by western blot with 12540-1-AP (Amylase, alpha antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12540-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human pancreas cancer using 12540-1-AP (same clone as 12540-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 12540-1-AP (Amylase, alpha antibody at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12540-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human pancreas cancer using 12540-1-AP (same clone as 12540-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 12540-1-AP (Amylase, alpha antibody at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12540-1-PBS in a different storage buffer formulation.

• 

  IF Staining of rat pancreas using 12540-1-AP (same clone as 12540-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded rat pancreas tissue using Amylase Alpha antibody (12540-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12540-1-PBS in a different storage buffer formulation.

Amylase Alpha Polyclonal Antibody for WB, IHC, IF-P, Indirect ELISA

Cat No. 12540-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, Indirect ELISA

Synonyms

AMY2B, Amylase, alpha, 1,4-alpha-D-glucan glucanohydrolase 2B, Alpha amylase, Alpha amylase 2B

---

Product Information

12540-1-PBS targets Amylase Alpha in WB, IHC, IF-P, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3260

  Product name: Recombinant human AMY2B protein

  Source: e coli.-derived, T-HIS

  Tag: 6*His

  Domain: 160-511 aa of BC011179

  Sequence: SGDIENYNDATQVRDCRLVGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFMPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVNFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWTFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL

• Full Name: amylase, alpha 2B (pancreatic)
• Calculated Molecular Weight: 511 aa, 58 kDa
• Observed Molecular Weight: 58 kDa
• GenBank Accession Number: BC011179
• Gene Symbol: AMY2B
• Gene ID (NCBI): 280
• RRID: AB_2273990
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P19961
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

AMY2B(alpha-amylase 2B) belongs to the glycosyl hydrolase 13 family. This protein is involved in the endohydrolysis of 1,4-alpha-glucosidic linkages in oligosaccharides and polysaccharides. The full length 58 kDa protein has a signal peptide with 15 amino acids. Human amylases (Amy1, Amy2A, and Amy2B) commonly have two potential N-glycosylation sites (N427 and N476) in their C-terminal region (S Takashima, J Amano, 2012). 12540-1-AP can recognize both AMY2A and AMY2B.