Mouse Angiopoietin-2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Mouse Angiopoietin-2 Polyclonal antibody, PBS Only (31499-1-PBS)

Angiopoietin-2 Polyclonal Antibody for WB, IHC, IP, Indirect ELISA

Cat No. 31499-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

mouse, rat

Applications

WB, IHC, IP, Indirect ELISA

Synonyms

Angpt2, Agpt2, Ang 2, Ang2, angiopoietin 2

• 

  WB analysis using 31499-1-AP (same clone as 31499-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 31499-1-AP (Angiopoietin-2 antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 31499-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 31499-1-AP (same clone as 31499-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 31499-1-AP (Angiopoietin-2 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 31499-1-PBS in a different storage buffer formulation.

• 

  IP experiment of rat lung using 31499-1-AP (same clone as 31499-1-PBS)

  IP result of anti-Angiopoietin-2 (IP:31499-1-AP, 4ug; Detection:31499-1-AP 1:3000) with rat lung tissue lysate 1200 ug. This data was developed using the same antibody clone with 31499-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 31499-1-AP (same clone as 31499-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 31499-1-AP (Angiopoietin-2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 31499-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse colon using 31499-1-AP (same clone as 31499-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse colon tissue slide using 31499-1-AP (Angiopoietin-2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 31499-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse colon using 31499-1-AP (same clone as 31499-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse colon tissue slide using 31499-1-AP (Angiopoietin-2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 31499-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 31499-1-AP (same clone as 31499-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 31499-1-AP (Angiopoietin-2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 31499-1-PBS in a different storage buffer formulation.

---

Product Information

31499-1-PBS targets Angiopoietin-2 in WB, IHC, IP, Indirect ELISA applications and shows reactivity with mouse, rat samples.

• Tested Reactivity: mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Eg0666

  Product name: recombinant mouse Angiopoietin-2 protein

  Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

  Tag: C-6*HIS

  Domain: 68-496 aa of NM_007426.4

  Sequence: DAPLDYDDSVQRLQVLENILENNTQWLMKLENYIQDNMKKEMVEIQQNVVQNQTAVMIEIGTSLLNQTAAQTRKLTDVEAQVLNQTTRLELQLLQHSISTNKLEKQILDQTSEINKLQNKNSFLEQKVLDMEGKHSEQLQSMKEQKDELQVLVSKQSSVIDELEKKLVTATVNNSLLQKQQHDLMETVNSLLTMMSSPNSKSSVAIRKEEQTTFRDCAEIFKSGLTTSGIYTLTFPNSTEEIKAYCDMDVGGGGWTVIQHREDGSVDFQRTWKEYKEGFGSPLGEYWLGNEFVSQLTGQHRYVLKIQLKDWEGNEAHSLYDHFYLAGEESNYRIHLTGLTGTAGKISSISQPGSDFSTKDSDNDKCICKCSQMLSGGWWFDACGPSNLNGQYYPQKQNTNKFNGIKWYYWKGSGYSLKATTMMIRPADF

• Full Name: angiopoietin 2
• Calculated Molecular Weight: 56KD
• Observed Molecular Weight: 68 kDa
• GenBank Accession Number: NM_007426.4
• Gene Symbol: Angpt2
• Gene ID (NCBI): 11601
• RRID: AB_3742440
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: O35608
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Angiopoietin-2 (ANGPT2, ANG-2) is as a regulator of vessel enlargement, and ANGPT2 inhibition prevented pathological vessel enlargement (PMID: 34758631). ANGPT2 destabilizes vessels and promotes angiogenesis through antagonism of ANGPT1 (PMID: 34758631). Ang2 was initially identified by homology with Ang1 and is expressed predominantly by endothelial cells, where it is stored in intracellular secretory granules called Weibel-Palade bodies (WPB) and promptly released after endothelium activation. Like Ang1, Ang2 binds to Tie2 receptor, but with different pathophysiological effects. While Ang1 fosters endothelial stabilization, Ang2 can antagonize Ang1, blocking Tie2 activation and leading to vessel destabilization (PMID: 31756341).