Annexin A4 Monoclonal antibody, PBS Only

• 

  WB analysis of COLO 320 using 60288-2-Ig (same clone as 60288-2-PBS)

  COLO 320 cells were subjected to SDS PAGE followed by western blot with 60288-2-Ig (Annexin IV antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 60288-2-PBS in a different storage buffer formulation.

• 

  WB analysis of human heart using 60288-2-Ig (same clone as 60288-2-PBS)

  human heart tissue were subjected to SDS PAGE followed by western blot with 60288-2-Ig (Annexin IV Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 60288-2-PBS in a different storage buffer formulation.

• 

  WB analysis of human placenta using 60288-2-Ig (same clone as 60288-2-PBS)

  human placenta tissue were subjected to SDS PAGE followed by western blot with 60288-2-Ig (Annexin IV antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 60288-2-PBS in a different storage buffer formulation.

• 

  WB analysis of A549 using 60288-2-Ig (same clone as 60288-2-PBS)

  A549 cells were subjected to SDS PAGE followed by western blot with 60288-2-Ig (Annexin IV antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 60288-2-PBS in a different storage buffer formulation.

• 

  IHC staining of human placenta using 60288-2-Ig (same clone as 60288-2-PBS)

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 60288-2-Ig (Annexin IV antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 60288-2-PBS in a different storage buffer formulation.

• 

  IHC staining of human placenta using 60288-2-Ig (same clone as 60288-2-PBS)

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 60288-2-Ig (Annexin IV antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 60288-2-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 60288-2-Ig (same clone as 60288-2-PBS)

  Immunofluorescent analysis of (10% Formaldehyde ) fixed HeLa cells using 60288-2-Ig(Annexin IV antibody) at dilution of 1:100 and Alexa Fluor 488-conjugated Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 60288-2-PBS in a different storage buffer formulation.

Annexin A4 Monoclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 60288-2-PBS

Clone No.1A10B5

Host / Isotype

Mouse / IgG2c

Reactivity

human

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

35-beta calcimedin, Annexin A4, Annexin IV, Annexin-4, ANXA4, Chromobindin-4, Endonexin I, Lipocortin IV

---

Product Information

60288-2-PBS targets Annexin A4 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG2c
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0130

  Product name: Recombinant human Annexin IV protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 33-202 aa of BC000182

  Sequence: GTDEDAIISVLAYRNTAQRQEIRTAYKSTIGRDLIDDLKSELSGNFEQVIVGMMTPTVLYDVQELRRAMKGAGTDEGCLIEILASRTPEEIRRISQTYQQQYGRSLEDDIRSDTSFMFQRVLVSLSAGGRDEGNYLDDALVRQDAQDLYEAGEKKWGTDEVKFLTVLCSR

• Full Name: annexin A4
• Calculated Molecular Weight: 36 kDa
• Observed Molecular Weight: 32 kDa
• GenBank Accession Number: BC000182
• Gene Symbol: Annexin A4
• Gene ID (NCBI): 307
• RRID: AB_2881405
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P09525
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Annexin A4 (Anxa4) is one of the Ca2 +-regulated and phospholipid-binding annexin superfamily proteins, and is located at 2p13. Anxa4 has a potential role in diagnosis, prognosis, and treatment of certain cancers. Annexin A4 shares 45 to 59% identity with other members and possibly interacts with ATP. Annexin A4 has in vitro anticoagulant activity and also inhibits phospholipase A2 activity. The Annexin A4 protein is expressed in a wide range of tissues, associated with polarized epithelial cells and is proposed to be involved in the regulation of chloride ions across the epithelial membrane.