Annexin A7 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Annexin A7 Polyclonal antibody, PBS Only (10154-2-PBS)

• 

  WB analysis using 10154-2-AP (same clone as 10154-2-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 10154-2-AP (Annexin A7 antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10154-2-PBS in a different storage buffer formulation.

• 

  WB analysis using 10154-2-AP (same clone as 10154-2-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 10154-2-AP (Annexin A7 antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10154-2-PBS in a different storage buffer formulation.

• 

  WB analysis of L02 using 10154-2-AP (same clone as 10154-2-PBS)

  L02 cells were subjected to SDS PAGE followed by western blot with 10154-2-AP (Annexin VII antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10154-2-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse lung using 10154-2-AP (same clone as 10154-2-PBS)

  mouse lung tissue were subjected to SDS PAGE followed by western blot with 10154-2-AP (Annexin VII antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10154-2-PBS in a different storage buffer formulation.

• 

  IP experiment of U-87 MG using 10154-2-AP (same clone as 10154-2-PBS)

  IP result of anti-Annexin A7 (IP:10154-2-AP, 4ug; Detection:10154-2-AP 1:8000) with U-87 MG cells lysate 1160 ug. This data was developed using the same antibody clone with 10154-2-PBS in a different storage buffer formulation.

• 

  IP experiment of mouse heart using 10154-2-AP (same clone as 10154-2-PBS)

  IP result of anti-Annexin A7 (IP:10154-2-AP, 4ug; Detection:10154-2-AP 1:800) with mouse heart tissue lysate 3200ug. This data was developed using the same antibody clone with 10154-2-PBS in a different storage buffer formulation.

• 

  IHC staining of human pancreas using 10154-2-AP (same clone as 10154-2-PBS)

  Immunohistochemical analysis of paraffin-embedded human pancreas tissue slide using 10154-2-AP (Annexin VII antibody at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 10154-2-PBS in a different storage buffer formulation.

• 

  IHC staining of human stomach using 10154-2-AP (same clone as 10154-2-PBS)

  Immunohistochemical analysis of paraffin-embedded human stomach tissue slide using 10154-2-AP (Annexin A7 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10154-2-PBS in a different storage buffer formulation.

• 

  IHC staining of human stomach using 10154-2-AP (same clone as 10154-2-PBS)

  Immunohistochemical analysis of paraffin-embedded human stomach tissue slide using 10154-2-AP (Annexin A7 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10154-2-PBS in a different storage buffer formulation.

• 

  IHC staining of human stomach cancer using 10154-2-AP (same clone as 10154-2-PBS)

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 10154-2-AP (Annexin A7 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10154-2-PBS in a different storage buffer formulation.

• 

  IHC staining of human stomach cancer using 10154-2-AP (same clone as 10154-2-PBS)

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 10154-2-AP (Annexin A7 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10154-2-PBS in a different storage buffer formulation.

• 

  IHC staining of rat stomach using 10154-2-AP (same clone as 10154-2-PBS)

  Immunohistochemical analysis of paraffin-embedded rat stomach tissue slide using 10154-2-AP (Annexin A7 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10154-2-PBS in a different storage buffer formulation.

• 

  IHC staining of rat stomach using 10154-2-AP (same clone as 10154-2-PBS)

  Immunohistochemical analysis of paraffin-embedded rat stomach tissue slide using 10154-2-AP (Annexin A7 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10154-2-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse stomach using 10154-2-AP (same clone as 10154-2-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse stomach tissue slide using 10154-2-AP (Annexin A7 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10154-2-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse stomach using 10154-2-AP (same clone as 10154-2-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse stomach tissue slide using 10154-2-AP (Annexin A7 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10154-2-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse heart using 10154-2-AP (same clone as 10154-2-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 10154-2-AP (Annexin A7 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10154-2-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse lung using 10154-2-AP (same clone as 10154-2-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 10154-2-AP (Annexin A7 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10154-2-PBS in a different storage buffer formulation.

• 

  IHC staining of human prostate cancer using 10154-2-AP (same clone as 10154-2-PBS)

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 10154-2-AP (Annexin VII antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10154-2-PBS in a different storage buffer formulation.

• 

  IHC staining of human prostate cancer using 10154-2-AP (same clone as 10154-2-PBS)

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 10154-2-AP (Annexin VII antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10154-2-PBS in a different storage buffer formulation.

• 

  FC experiment of SH-SY5Y using 10154-2-AP (same clone as 10154-2-PBS)

  1X10^6 SH-SY5Y cells were intracellularly stained with 0.4 ug Anti-Human Annexin A7 (10154-2-AP) and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) at dilution 1:1000 (red), or 0.4 ug Control Antibody. Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 10154-2-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

Annexin A7 Polyclonal Antibody for WB, IHC, FC (Intra), IP, Indirect ELISA

Cat No. 10154-2-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, FC (Intra), IP, Indirect ELISA

Synonyms

ANXA7, OK/SW-cl.95, ANX7, Annexin-7, Annexin VII

---

Product Information

10154-2-PBS targets Annexin A7 in WB, IHC, FC (Intra), IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0206

  Product name: Recombinant human ANXA7 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 236-466 aa of BC002632

  Sequence: PTYYDAWSLRKAMQGAGTQERVLIEILCTRTNQEIREIVRCYQSEFGRDLEKDIRSDTSGHFERLLVSMCQGNRDENQSINHQMAQEDAQRLYQAGEGRLGTDESCFNMILATRSFPQLRATMEAYSRMANRDLLSSVSREFSGYVESGLKTILQCALNRPAFFAERLYYAMKGAGTDDSTLVRIVVTRSEIDLVQIKQMFAQMYQKTLGTMIAGDTSGDYRRLLLAIVGQ

• Full Name: annexin A7
• Calculated Molecular Weight: 50 kDa
• Observed Molecular Weight: 47 kDa, 51 kDa
• GenBank Accession Number: BC002632
• Gene Symbol: Annexin A7
• Gene ID (NCBI): 310
• RRID: AB_2227386
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P20073
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Annexin A7 (Anx7) belongs to a ubiquitous and relatively abundant family of Ca2+-dependent membrane-binding proteins, which are thought to be involved in multiple aspects of cell biology including membrane trafficking, mediation of cell-matrix interactions and membrane organization within cells. Anx7, migrated as a 50 kDa protein in SDS-PAGE, has been proposed to function in the fusion of vesicles, acting as a Ca++ channel and as Ca++ -activated GTPase, thus inducing Ca++ /GTP-dependent secretory events.