Annexin V Monoclonal antibody, PBS Only

• 

  WB analysis using 66245-1-Ig (same clone as 66245-1-PBS)

  Various cells were subjected to SDS PAGE followed by western blot with 66245-1-Ig (Annexin V antibody) at dilution of 1:13000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66245-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 66245-1-Ig (same clone as 66245-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 66245-1-Ig (Annexin V antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66245-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse brain using 66245-1-Ig (same clone as 66245-1-PBS)

  Mouse brain tissue were subjected to SDS PAGE followed by western blot with 66245-1-Ig (Annexin V antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66245-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 66245-1-Ig (same clone as 66245-1-PBS)

  WB result of Annexin V antibody (66245-1-Ig; 1:10000; incubated at room temperature for 1.5 hours) with sh-Control and sh-Annexin V transfected HeLa cells. This data was developed using the same antibody clone with 66245-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 66245-1-Ig (same clone as 66245-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 66245-1-Ig (Annexin V antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66245-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 66245-1-Ig (same clone as 66245-1-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 66245-1-Ig (Annexin V antibody at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66245-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human malignant melanoma using 66245-1-Ig (same clone as 66245-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human malignant melanoma tissue slide using 66245-1-Ig (Annexin V antibody at dilution of 1:200 (under 10x lens). This data was developed using the same antibody clone with 66245-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human malignant melanoma using 66245-1-Ig (same clone as 66245-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human malignant melanoma tissue slide using 66245-1-Ig (Annexin V antibody at dilution of 1:200 (under 40x lens). This data was developed using the same antibody clone with 66245-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human spleen using 66245-1-Ig (same clone as 66245-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human spleen tissue slide using 66245-1-Ig (Annexin V antibody at dilution of 1:200 (under 10x lens). This data was developed using the same antibody clone with 66245-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human spleen using 66245-1-Ig (same clone as 66245-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human spleen tissue slide using 66245-1-Ig (Annexin V antibody at dilution of 1:200 (under 40x lens). This data was developed using the same antibody clone with 66245-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon using 66245-1-Ig (same clone as 66245-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 66245-1-Ig (Annexin V antibody at dilution of 1:200 (under 10x lens). This data was developed using the same antibody clone with 66245-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon using 66245-1-Ig (same clone as 66245-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 66245-1-Ig (Annexin V antibody at dilution of 1:200 (under 40x lens). This data was developed using the same antibody clone with 66245-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 66245-1-Ig (same clone as 66245-1-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed HeLa cells using Annexin V antibody (66245-1-Ig, Clone: 1E6A8 ) at dilution of 1:800 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 66245-1-PBS in a different storage buffer formulation.

• 

  FC experiment of NIH/3T3 using 66245-1-Ig (same clone as 66245-1-PBS)

  1x10^6 NIH/3T3 cells were intracellularly stained with 0.25 ug Annexin V Monoclonal antibody (66245-1-Ig, Clone:1E6A8) and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) (SA00013-1)(red), or 0.25 ug Mouse IgG1 isotype control Mouse McAb (66360-1-Ig, Clone: 1F8D3) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer (PF00011-C). This data was developed using the same antibody clone with 66245-1-PBS in a different storage buffer formulation.

• 

  FC experiment of HeLa using 66245-1-Ig (same clone as 66245-1-PBS)

  1x10^6 HeLa cells were intracellularly stained with 0.25 ug Annexin V Monoclonal antibody (66245-1-Ig, Clone:1E6A8) and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) (SA00013-1)(red), or 0.25 ug Mouse IgG1 isotype control Mouse McAb (66360-1-Ig, Clone: 1F8D3) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer (PF00011-C). This data was developed using the same antibody clone with 66245-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

Annexin V Monoclonal Antibody for WB, IHC, IF/ICC, FC (Intra), Indirect ELISA

Cat No. 66245-1-PBS

Clone No.1E6A8

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, pig

Applications

WB, IHC, IF/ICC, FC (Intra), Indirect ELISA

Synonyms

Annexin A5, ANXA5, Anchorin CII, Annexin 5, Annexin-5

---

Product Information

66245-1-PBS targets Annexin V in WB, IHC, IF/ICC, FC (Intra), Indirect ELISA applications and shows reactivity with human, mouse, pig samples.

• Tested Reactivity: human, mouse, pig
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1538

  Product name: Recombinant human ANXA5 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-320 aa of BC001429

  Sequence: MAQVLRGTVTDFPGFDERADAETLRKAMKGLGTDEESILTLLTSRSNAQRQEISAAFKTLFGRDLLDDLKSELTGKFEKLIVALMKPSRLYDAYELKHALKGAGTNEKVLTEIIASRTPEELRAIKQVYEEEYGSSLEDDVVGDTSGYYQRMLVVLLQANRDPDAGIDEAQVEQDAQALFQAGELKWGTDEEKFITIFGTRSVSHLRKVFDKYMTISGFQIEETIDRETSGNLEQLLLAVVKSIRSIPAYLAETLYYAMKGAGTDDHTLIRVMVSRSEIDLFNIRKEFRKNFATSLYSMIKGDTSGDYKKALLLLCGEDD

• Full Name: annexin A5
• Calculated Molecular Weight: 36 kDa
• Observed Molecular Weight: 36 kDa
• GenBank Accession Number: BC001429
• Gene Symbol: Annexin V
• Gene ID (NCBI): 308
• RRID: AB_2881634
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P08758
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Annexin A5 (ANXA5), is a member of the structurally related family of annexin proteins some of which have been implicated in membrane-related events along exocytotic and endocytotic pathways. Annexin 5 is a phospholipase A2 and protein kinase C inhibitory protein with calcium channel activity and a potential role in cellular signal transduction, inflammation, growth and differentiation. Annexin 5 has also been described as placental anticoagulant protein I, vascular anticoagulant-alpha, endonexin II, lipocortin V, placental protein 4 and anchorin CII.