• Featured Product
  • KD/KO Validated

Annexin V Monoclonal antibody

Annexin V Monoclonal Antibody for WB, IHC, IF/ICC, FC (Intra), ELISA

Cat No. 66245-1-Ig
Clone No.1E6A8

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, pig

Applications

WB, IHC, IF/ICC, FC (Intra), ELISA

Annexin A5, ANXA5, Anchorin CII, Annexin 5, Annexin-5

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inMG-63 cells, HEK-293 cells, HeLa cells, HepG2 cells, human urine exosomes tissue, mouse brain tissue, Raw 264.7 cells, NIH/3T3 cells, K-562 cells, U-87 MG cells, MDA-MB-231 cells, pig brain tissue
Positive IHC detected inhuman malignant melanoma tissue, human colon tissue, human spleen tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHeLa cells
Positive FC (Intra) detected inNIH/3T3 cells, HeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:400-1:1600
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

IFSee 1 publications below

Product Information

66245-1-Ig targets Annexin V in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse, pig samples.

Tested Reactivity human, mouse, pig
Cited Reactivityhuman
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag1538

Product name: Recombinant human ANXA5 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-320 aa of BC001429

Sequence: MAQVLRGTVTDFPGFDERADAETLRKAMKGLGTDEESILTLLTSRSNAQRQEISAAFKTLFGRDLLDDLKSELTGKFEKLIVALMKPSRLYDAYELKHALKGAGTNEKVLTEIIASRTPEELRAIKQVYEEEYGSSLEDDVVGDTSGYYQRMLVVLLQANRDPDAGIDEAQVEQDAQALFQAGELKWGTDEEKFITIFGTRSVSHLRKVFDKYMTISGFQIEETIDRETSGNLEQLLLAVVKSIRSIPAYLAETLYYAMKGAGTDDHTLIRVMVSRSEIDLFNIRKEFRKNFATSLYSMIKGDTSGDYKKALLLLCGEDD

Predict reactive species
Full Name annexin A5
Calculated Molecular Weight 36 kDa
Observed Molecular Weight 36 kDa
GenBank Accession NumberBC001429
Gene Symbol Annexin V
Gene ID (NCBI) 308
RRIDAB_2881634
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP08758
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Annexin A5 (ANXA5), is a member of the structurally related family of annexin proteins some of which have been implicated in membrane-related events along exocytotic and endocytotic pathways. Annexin 5 is a phospholipase A2 and protein kinase C inhibitory protein with calcium channel activity and a potential role in cellular signal transduction, inflammation, growth and differentiation. Annexin 5 has also been described as placental anticoagulant protein I, vascular anticoagulant-alpha, endonexin II, lipocortin V, placental protein 4 and anchorin CII.

Protocols

Product Specific Protocols
FC protocol for Annexin V antibody 66245-1-IgDownload protocol
IF protocol for Annexin V antibody 66245-1-IgDownload protocol
IHC protocol for Annexin V antibody 66245-1-IgDownload protocol
WB protocol for Annexin V antibody 66245-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanIF

PLoS Pathog

IL-17RA promotes pathologic epithelial inflammation in a mouse model of upper respiratory influenza infection

Authors - Zahrasadat Navaeiseddighi

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Vivienne (Verified Customer) (01-16-2025)

Nice, clear bands, easy to use, no problems while using our standard methods in our lab. Usable for semi dry turbo blotting. Exceeded my expectations as the product has never been tested before for the cell lines we use.

  • Applications: Western Blot
  • Cell Tissue Type: Breast cancer cells: MDA-MB-231, MDA-MB-435, HS 578 T; Epithelial cells: M13 SV1
Annexin V Antibody Western Blot validation ( dilution) in Breast cancer cells: MDA-MB-231, MDA-MB-435, HS 578 T; Epithelial cells: M13 SV1 (Cat no:66245-1-Ig)
Loading...
||
New chat

Able

正在加载,请稍候...