Tested Applications
| Positive WB detected in | MG-63 cells, HEK-293 cells, HeLa cells, HepG2 cells, human urine exosomes tissue, mouse brain tissue, Raw 264.7 cells, NIH/3T3 cells, K-562 cells, U-87 MG cells, MDA-MB-231 cells, pig brain tissue |
| Positive IHC detected in | human malignant melanoma tissue, human colon tissue, human spleen tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
| Positive FC (Intra) detected in | NIH/3T3 cells, HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:400-1:1600 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
66245-1-Ig targets Annexin V in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse, pig samples.
| Tested Reactivity | human, mouse, pig |
| Cited Reactivity | human |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag1538 Product name: Recombinant human ANXA5 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-320 aa of BC001429 Sequence: MAQVLRGTVTDFPGFDERADAETLRKAMKGLGTDEESILTLLTSRSNAQRQEISAAFKTLFGRDLLDDLKSELTGKFEKLIVALMKPSRLYDAYELKHALKGAGTNEKVLTEIIASRTPEELRAIKQVYEEEYGSSLEDDVVGDTSGYYQRMLVVLLQANRDPDAGIDEAQVEQDAQALFQAGELKWGTDEEKFITIFGTRSVSHLRKVFDKYMTISGFQIEETIDRETSGNLEQLLLAVVKSIRSIPAYLAETLYYAMKGAGTDDHTLIRVMVSRSEIDLFNIRKEFRKNFATSLYSMIKGDTSGDYKKALLLLCGEDD Predict reactive species |
| Full Name | annexin A5 |
| Calculated Molecular Weight | 36 kDa |
| Observed Molecular Weight | 36 kDa |
| GenBank Accession Number | BC001429 |
| Gene Symbol | Annexin V |
| Gene ID (NCBI) | 308 |
| RRID | AB_2881634 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | P08758 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Annexin A5 (ANXA5), is a member of the structurally related family of annexin proteins some of which have been implicated in membrane-related events along exocytotic and endocytotic pathways. Annexin 5 is a phospholipase A2 and protein kinase C inhibitory protein with calcium channel activity and a potential role in cellular signal transduction, inflammation, growth and differentiation. Annexin 5 has also been described as placental anticoagulant protein I, vascular anticoagulant-alpha, endonexin II, lipocortin V, placental protein 4 and anchorin CII.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for Annexin V antibody 66245-1-Ig | Download protocol |
| IF protocol for Annexin V antibody 66245-1-Ig | Download protocol |
| IHC protocol for Annexin V antibody 66245-1-Ig | Download protocol |
| WB protocol for Annexin V antibody 66245-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The Annexin V Monoclonal antibody (1E6A8), catalog number 66245-1-Ig, has 3 citations. They appear in Biochemical Pharmacology, PLoS Pathogens, and Food and Chemical Toxicology. Research fields span liver fibrosis and ER stress-dependent hepatic stellate cell activation, pathologic epithelial inflammation in upper respiratory influenza infection, and lung squamous cell carcinoma migration in response to phthalates. Applications cited include immunofluorescence and Western blot in human samples.
| Species | Application | Title |
|---|---|---|
Biochem Pharmacol G22037, a novel oxadiazole-pyrazole derivative, attenuates liver fibrosis by targeting annexin A5 and inhibition of ER stress-dependent hepatic stellate cell activation. | ||
PLoS Pathog IL-17RA promotes pathologic epithelial inflammation in a mouse model of upper respiratory influenza infection | ||
Food Chem Toxicol Multiple targets and pathways non-monotonically regulate lung squamous cell carcinoma migration in response to phthalates. |
Reviews
What customers say
The single review is a 5-star rating from a researcher who used the antibody for Western Blot on breast cancer and epithelial cell lines (MDA-MB-231, MDA-MB-435, HS 578T, M13 SV1). They reported nice, clear bands and ease of use with their standard lab methods, noting it also works well for semi-dry turbo blotting. The reviewer was pleasantly surprised by the performance, as the product had not been previously tested on the specific cell lines they use. Overall, the experience exceeded expectations.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Vivienne (Verified Customer) (01-16-2025) | Nice, clear bands, easy to use, no problems while using our standard methods in our lab. Usable for semi dry turbo blotting. Exceeded my expectations as the product has never been tested before for the cell lines we use.
![]() |
































