Home
Products
Primary Antibodies
Apelin Polyclonal antibody, PBS Only (11497-1-PBS)

Filter: AllIHCIF-PIF/ICC

IHC staining of human colon cancer using 11497-1-AP (same clone as 11497-1-PBS)
Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 11497-1-AP (Apelin antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11497-1-PBS in a different storage buffer formulation.
IHC staining of human colon cancer using 11497-1-AP (same clone as 11497-1-PBS)
Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 11497-1-AP (Apelin antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11497-1-PBS in a different storage buffer formulation.
IHC staining of mouse brain using 11497-1-AP (same clone as 11497-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 11497-1-AP (Apelin antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11497-1-PBS in a different storage buffer formulation.
IHC staining of mouse placenta using 11497-1-AP (same clone as 11497-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse placenta tissue slide using 11497-1-AP (Apelin antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11497-1-PBS in a different storage buffer formulation.
IHC staining of human placenta using 11497-1-AP (same clone as 11497-1-PBS)
Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 11497-1-AP (Apelin antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11497-1-PBS in a different storage buffer formulation.
IHC staining of rat heart using 11497-1-AP (same clone as 11497-1-PBS)
Immunohistochemical analysis of paraffin-embedded rat heart tissue slide using 11497-1-AP (Apelin antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11497-1-PBS in a different storage buffer formulation.
IHC staining of mouse heart using 11497-1-AP (same clone as 11497-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 11497-1-AP (Apelin antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11497-1-PBS in a different storage buffer formulation.
IHC staining of human colon cancer using 11497-1-AP (same clone as 11497-1-PBS)
Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 11497-1-AP (Apelin antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11497-1-PBS in a different storage buffer formulation.
IHC staining of human colon cancer using 11497-1-AP (same clone as 11497-1-PBS)
Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 11497-1-AP (Apelin antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11497-1-PBS in a different storage buffer formulation.
IHC staining of mouse heart using 11497-1-AP (same clone as 11497-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 11497-1-AP (Apelin antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11497-1-PBS in a different storage buffer formulation.
IHC staining of mouse heart using 11497-1-AP (same clone as 11497-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 11497-1-AP (Apelin antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11497-1-PBS in a different storage buffer formulation.
IHC staining of human colon cancer using 11497-1-AP (same clone as 11497-1-PBS)
Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 11497-1-AP (Apelin antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11497-1-PBS in a different storage buffer formulation.
IHC staining of human colon cancer using 11497-1-AP (same clone as 11497-1-PBS)
Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 11497-1-AP (Apelin antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11497-1-PBS in a different storage buffer formulation.
IF Staining of human placenta using 11497-1-AP (same clone as 11497-1-PBS)
Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded human placenta tissue using Apelin antibody (11497-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11497-1-PBS in a different storage buffer formulation.
IF Staining of human placenta using 11497-1-AP (same clone as 11497-1-PBS)
Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded human placenta tissue using Apelin antibody (11497-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11497-1-PBS in a different storage buffer formulation.
IF Staining of mouse brain using 11497-1-AP (same clone as 11497-1-PBS)
Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse brain tissue using Apelin antibody (11497-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11497-1-PBS in a different storage buffer formulation.
IF Staining of HepG2 using 11497-1-AP (same clone as 11497-1-PBS)
Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using Apelin antibody (11497-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-phalloidin (red). This data was developed using the same antibody clone with 11497-1-PBS in a different storage buffer formulation.

Apelin Polyclonal antibody, PBS Only

Name: Apelin Polyclonal antibody, PBS Only
Brand: Proteintech
SKU: 11497-1-PBS

Apelin Polyclonal Antibody for IHC, IF/ICC, IF-P, Indirect ELISA

Cat No. 11497-1-PBS

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IHC, IF/ICC, IF-P, Indirect ELISA

Synonyms

APLN, APEL, APJ endogenous ligand

Formulation: PBS Only

PBS, Azide, Glycerol

Conjugate: Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

11497-1-PBS targets Apelin in IHC, IF/ICC, IF-P, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag2047 Product name: Recombinant human APLN protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-77 aa of BC021104 Sequence: MNLRLCVQALLLLWLSLTAVCGGSLMPLPDGNGLEDGNVRHLVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF Predict reactive species
Full Name	apelin
Calculated Molecular Weight	77 aa, 9 kDa
GenBank Accession Number	BC021104
Gene Symbol	Apelin
Gene ID (NCBI)	8862
RRID	AB_2877771
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	Q9ULZ1
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

Apelin, isolated from bovine stomach tissue extractsis, is recognized as the endogenous ligand of the angiotensin-like-receptor 1 (APJ), and the human orphan G-protein-coupled receptor. Apelin is widely expressed in various organs such as the heart, lung, kidney, liver, adipose tissue, gastrointestinal tract, brain, adrenal glands, endothelium, and human plasma. Apelin has been found to be a potent stimulator of cardiac contractility and may function in the regulation of the cardiovascular system. Apelin is also known to be involved in the maintenance of INS sensitivity and play an important role in liver disease.